KEGG   Drosophila yakuba: Dyak_GE20132Help
Entry
Dyak_GE20132      CDS       T01068                                 

Definition
GE20132 gene product from transcript GE20132-RA
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dya  Drosophila yakuba
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE20132
Enzymes [BR:dya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dyak_GE20132
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE20132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 327 aa AA seqDB search
MERKLHSGMHHPTLRQLQESGCEIAPHNLMYPVFIVSNNDDVQPIASMPGISRLGLNRLR
EHLEPLVAKGLSSVLLFGVVEPELKDEQASNADSAKNPVVLALPKLREWFPDLLIACDVC
ICPYSSHGHCGLLGETGLENGPSIKRIAEIAVAYAKAGAHIVAPSDMMDNRVKAIKQALI
DAQMNSVSLLAYSAKFTSNFYGPFREAAQSAPKFGDRRCYQLPSGSRNLAMRAIQRDVAE
GADMLMVKPGMPYLDILRSTKDSYPYHTLYVYQVSGEYAMLYHAAKAEAFDLKDAVLEVM
KGFRRAGADCIITYYTPFLLDIIAEAK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggagaggaaactgcacagtggaatgcaccatcccaccctgcggcagctgcaggagtcg
ggctgcgagatagcgccgcacaatctcatgtatccggtgttcatcgtgagcaacaacgac
gacgtgcagccgattgccagcatgccgggaatctcgagactcggactgaatcgcctgagg
gagcacctggagccgctggtggccaagggattgtcgtcggtgctgctctttggcgtcgtg
gagccggagctgaaggatgagcaggcctccaatgcggattccgcaaagaatccagtggtt
ctagctctgccaaagctccgggaatggtttccagatctgctgatagcctgtgatgtgtgc
atctgcccgtactcctcgcacggtcattgtggtctcctgggcgaaacgggactggagaac
ggacccagcataaagcggatagctgagattgccgtggcttatgccaaagcaggagcccac
attgtggctccttcggacatgatggacaaccgggtgaaggcgatcaagcaggccctcatt
gatgcccagatgaacagcgtgtccctgctggcgtactccgccaagttcacctccaatttc
tacggacccttcagggaggcggcgcaatccgcaccgaaattcggcgaccgcaggtgctat
cagctgcccagtggctccaggaacttggccatgagagccattcaacgcgatgtcgccgag
ggcgcagacatgctgatggtgaaacctggaatgccttatctggacattctccgctccacg
aaggattcctacccgtatcacacgctgtacgtttaccaggtttccggggagtacgctatg
ttgtatcatgctgccaaggcggaagccttcgacctcaaggatgccgtactggaggtcatg
aagggcttccggcgcgctggtgcggattgcatcatcacctactacacaccctttctgctg
gacattatcgcagaggcgaaataa

DBGET integrated database retrieval system