KEGG   Drosophila yakuba: Dyak_GE20176Help
Entry
Dyak_GE20176      CDS       T01068                                 

Definition
GE20176 gene product from transcript GE20176-RA
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dya  Drosophila yakuba
Pathway
Amino sugar and nucleotide sugar metabolism
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dya00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 316 aa AA seqDB search
MARIVESNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTLVDPNDKYLLP
LIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATIDNELVIRPYTPISSDEDVGYV
DLVVKVYFKDTHPKFPTGGKMTQHLEQLELGDKISFRGPSGRLQYLGNGTFSIKKLRKDP
PKLVSAKRVNMIAGGTGITPMLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDEL
AEKHPDQFKVWYTVDKAGEGWQYSVGFINEDMIAAHLLPANDDTIVLLCGPPPMINFACN
PSLDKLGYHPDTRFAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatcgttgagagcaattttgtgccactagcggtgggtgtggtcgccgtactc
gcaggcgccctgatcgtccattatctgctgaataaaaagtccacgaaaccacgccgggaa
cccaatcgcaccgccaggctgcgcacgcttgtggatcccaacgacaagtatctgctgcca
ctcatcgaaaaggagaatctgagccatgacactaggagattccggtttggattgccctcc
aagcagcacgtccttggcctgcctgttggtcagcacattcatctgattgccaccatcgac
aatgaactggtgattcggccatacacacctatatcgtccgatgaggatgtgggctacgtc
gacctagtcgtcaaggtgtacttcaaggacacgcatcccaagttcccgaccggcggtaaa
atgacgcaacacctggagcagctagagttgggggacaagatctcgttccgtggtccctcg
ggtaggctacaatatctcggcaatggcaccttctccataaaaaagttgcgcaaggatccg
cccaagctcgtgtccgccaagcgggtcaacatgattgccggcggcactggcattactcca
atgctccaattggccagagaagtgctcaaacgcagcgacaaggataagactgaactggcg
ttgctcttcgccaatcagagcgaaaaggacattctgctgcgtgcggagttggacgaactg
gccgaaaagcatcctgaccagtttaaggtctggtacacagttgacaaggccggcgaaggt
tggcagtacagtgttggcttcatcaatgaggacatgatcgccgcccacctgcttccggcc
aatgacgataccattgtgttgctttgcggcccaccacctatgattaactttgcctgcaat
ccgtcgctggacaagcttggctaccacccggacacccgttttgcctactaa

DBGET integrated database retrieval system