KEGG   Drosophila yakuba: Dyak_GE20197Help
Entry
Dyak_GE20197      CDS       T01068                                 

Definition
GE20197 gene product from transcript GE20197-RA
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE20197
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   Dyak_GE20197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 659 aa AA seqDB search
MTIKPVSAPPSAKRVAGNVDPDNKEAQVVVVEQSVVSQTHNHAHNHRNVVIDGQSPQRRG
EVYDELARTHRCSPHKSTRSKRRDHHEAHAHLYKRDRLEREKLVHPTAAAGSGAPGVSGS
KCNSPPLASTSGSSSPSAVGRNSPEHLGLGCTTVPTAQVQMSPATAAANLLKTVEETFSG
YNSGDEHLQPKERLIPVEEWQRRDLEFAKCMEQRGYELKPVEEDGACLFRSISLQIYGDE
EMHDVIRQHTMDYIHENREYFGQFVTEDINSYIQRKRARDAHGNHIEIQAISEIYSRTVE
VYCYQSNPINIFNSEQSQAGYPPLRLSYQRGSHYNAILDPYNATVGVGLGLAGYKPEIQT
KEAARLSEQLEIEQTMFEDKLKTTDWEATNEAIEEQIARESYLQWCRENMQRSRSSNTAA
GSATSSTVTSAEALTDSDASPSKYSVCGGTGSSSNPPVTLTSGSGGDGTGPAFSLSPKTL
SQFSHKLPPEVNELGGYDSDATDMSSTSSVGHCGGSSSPSTAASQRSGKGSKSQRRTTAL
RKKRRHETREAPLASKSAEALEAPLRKSPKRDSAPSVARANTPEAEQRPSTSKQSSHSPQ
KSGDGQSPREKSYSSFYQELLEASYANEGANESEMLQQAIQMSTRDYMEDQKRKFLCGP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaagccagtgagcgcaccaccgagcgccaaacgcgtagctggaaatgtggat
cccgataacaaggaggcccaggtggttgtggtggagcagtcggtggtcagccagacccat
aatcatgcccacaaccaccgtaacgtcgtcatcgatgggcagagcccccagaggcgtggc
gaggtctacgacgaactggcacgcacccatcgctgcagcccacacaagagcacacgctcg
aagcgtcgagatcaccacgaagcgcatgcacacctgtataagcgcgatcgtctggagcgc
gagaaactagtccatccgacggcagcggcgggcagcggagcacctggtgtatctggcagt
aaatgcaacagtccaccattggcctcaacttctggcagtagcagtccgtcggcggtgggc
agaaactcacccgaacacttgggactgggttgcaccacggtgcccacagctcaggtccag
atgtctccggctacggcggcagccaatttgctcaaaacagtggaggaaaccttttccggt
tacaatagcggcgatgagcatctacagcccaaggagcgattgattccagtggaagagtgg
cagcgacgcgatctggagttcgccaagtgtatggaacagcgcggctatgaacttaagcct
gtcgaggaggatggcgcctgcctgtttcgctctatatcccttcaaatatacggcgacgag
gagatgcacgacgtgatccgccaacacaccatggattacattcacgagaatcgggaatat
tttggtcagtttgtcaccgaggacatcaacagctatatacagcgtaaacgagcccgggac
gctcatggcaaccacattgagatccaggctatttcagagatctacagccgtaccgtcgag
gtctactgctaccagtcaaatcccatcaatatatttaactcggaacagtcgcaggcaggt
tatcctccgctgcggttatcctatcagcgtggatcgcactacaatgctattttggatccc
tacaacgccaccgttggcgtgggcctgggcttggctggatacaagccggagatccaaacc
aaagaggctgcgcgtctcagcgagcagttggagatcgaacaaaccatgtttgaagataaa
ctaaagactacagattgggaggccactaacgaagccattgaggagcaaatcgcacgcgag
tcttacctgcagtggtgccgcgaaaacatgcaacgttcgcgcagcagcaatacggcggca
ggatcagccacatcctcgacggttacctctgcagaagcgcttaccgattcagatgcctcg
ccctcaaaatactctgtatgtgggggcaccggcagcagcagtaatccacctgtgactttg
acgagcggtagtggtggtgatggcacaggccccgcgttttcgctgtcccctaaaacacta
agtcagttcagtcacaagctgccgcctgaggtgaacgagctgggtggctacgatagcgat
gctactgacatgagtagtaccagctcggtgggacactgcggtggcagttcatcaccgagc
acagctgcaagccaacgttccggcaagggatccaagtcacagcgtcgcaccacggctctc
agaaagaagcgacgacacgaaacgcgcgaggcgcctttggctagcaagagcgccgaggct
ttggaggctccgctgaggaagagtccaaagcgcgattcagcgccatcggtggcacgagct
aacacgccagaggctgagcagcgtccctccacctcaaagcagtcgtctcattcgccacag
aagagcggggatggccagtcacccagggagaagagttactctagcttttaccaggagctg
ctcgaggcatcctacgccaatgaaggcgctaacgagagcgagatgctgcagcaagccatc
cagatgtccacacgcgattacatggaggaccaaaaacgaaagtttctctgcggaccgtag

DBGET integrated database retrieval system