KEGG   Drosophila yakuba: Dyak_GE20200Help
Entry
Dyak_GE20200      CDS       T01068                                 

Definition
GE20200 gene product from transcript GE20200-RA
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dya  Drosophila yakuba
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Dyak_GE20200
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     Dyak_GE20200
Glycosyltransferases [BR:dya01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   Dyak_GE20200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 892 aa AA seqDB search
MSATYTNTITQRRKTAKVKQQSQPQQQQQWTDSDMSCESNERLHFRSRSTNSKQQQQHTA
HSNSPSPLCCNGARALTMLNCCVDVNCHLNAPLRGSVNRHTTPTPTPTATPTPVPTPKQA
SPSPTSDRSRSLSRSLSPSRSRSLSCQKQINKNSAGAASAAERKTASASTQPFTVNLSID
LFSWTLFLLAFGTRFYKLATPPHIVFDELHYGKYISMYMRNIFFFDQHPPLGKQLIAGLV
SMAGYDGNYTFNRIGEPYAPEMPIFWFRFVPAMCGSLLAPGVYNLLLEAKLSRWSAALGG
LLVVLDNSLLTQSRFVLMESMLLLATTVGIACLLRFQRSRLGSLEWFFSGTTAAVFLGAA
GTVKYVGFLALGLAFYLLCRHLWQLLYDANLTDRQLWMHAISRLLIFVGIPFAVYVGVFY
VHFKTLYRAGPHDSIMTSAFQASLDGGLASITQGQPLAVVHGSQITLRHTHGRTCWLHSH
AAVYPVRYPDKRGSSHQQQVTCYSFKDVNNWWLVKRPTKENLVVGDEPDIIRHGEIIQLV
HGITSRALNSHDVAAPMTPQCQEVSCYIDYEIKMAGELLWRVDILNRDSEGDIWHAIKSE
VRLVHVSTEASLKFSGLQLPEWGFNQHEVVADREKGIHEDTIWNVEEHRYTQTEDHRERE
RQMLTAEMIPTKRTHISFWAKLLELQSKMLFQAKSVPSHMYSSMPHEWPLMDKGIAYWLD
SKSSAQIYLLGNVLIWYTATTGILVYAGLLAFYAMRRQRLCFDISEQEWQRFIIAGDTFF
MGYVMHYLPYFCVDRTLFLHNYLPAFVFKLLLLCFVADHLDYLLRRFCTGRGVHLVRLYR
LMLILWLVGVLSIFSKFIPFSYGAKKMTLNEVRNLRWKDTWDFVLHKNHHLH
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacctacaccaatacaattacacagcgccgcaagacggccaaagtgaagcag
caatcacaaccacaacaacaacaacaatggacggacagcgatatgagctgcgagtcaaac
gaaagacttcactttcgcagccgttcaacaaactcgaagcaacaacaacaacacacggca
cacagcaactcaccttcaccactgtgctgtaacggtgctcgtgctctaacaatgctcaat
tgctgcgtcgacgtcaactgtcatttgaatgcgccgctgcgcggcagcgttaaccggcac
acgacgccaacgccgacaccgactgcgactccaacgccggtaccgacgccaaaacaagcc
tccccctcgccaacctccgatcgttcgcgctcactctcacgttcgctctcgccctctcgg
tctcgctcgctctcctgccaaaaacagatcaacaagaacagcgcaggcgcagcatctgca
gctgaaagaaaaacagctagtgcgagtacgcagccatttaccgttaacctgagcatcgat
ctcttcagttggactctctttctcttggccttcggcacgcgtttctacaagctggcaacg
ccgccgcacatcgtttttgatgaactgcactacggcaagtacatctccatgtacatgcgc
aacattttcttctttgatcaacatccgccactgggcaaacagctgatcgccggactggtg
agcatggctggctacgatggcaattacaccttcaaccggattggagagccctatgcgccg
gaaatgcccatattttggttccggtttgtgccagccatgtgcggcagtctactggccccc
ggcgtttacaatctgttgctggaggctaaactcagtcgctggtcagccgccttgggtggt
ctgcttgtggtcctggacaactccttgctgacgcaatcccgctttgttctcatggaatca
atgctgctgctggccaccacagtgggcatcgcctgtttgctccgcttccaacgaagtcgc
ctaggcagtcttgaatggttctttagtggaacgacagctgccgtcttcttgggagccgcc
ggaacagtcaagtacgttggattcctggcactggggctagccttttatttgctgtgtcga
cacctgtggcaactgctctacgacgccaatcttaccgatcgccaactatggatgcatgcc
ataagtcgcctgttaatcttcgttggcattccatttgccgtctatgtgggagtcttctat
gtccacttcaagacgctataccgggctggaccgcacgatagtatcatgactagcgcgttt
caggcctcgttggatggaggactggcatcgatcacacaaggacagcctttggcagtggtt
catggctcccaaatcacactgcgccatacccacggacgcacctgctggctgcactcgcat
gcagctgtctatccggtgcggtacccggacaagaggggctcctcgcaccagcagcaggtc
acctgctactccttcaaggatgtgaacaactggtggctggttaagcgaccaacaaaggaa
aacctagtggtgggagatgagccggatatcatccgacacggtgaaattattcagttggtc
catggtatcacgagccgagcactgaactcacacgatgtggctgcgccaatgacaccgcag
tgccaggaggtcagctgttacatagattacgagatcaagatggccggtgagctgctgtgg
cgcgtggacattctgaatcgcgattccgagggtgacatttggcatgccatcaagtcggag
gtccgcctcgttcacgtgtccacagaagcctccttgaagttcagcggcctccaacttccc
gaatggggtttcaatcagcacgaggtggtggcggatcgagaaaagggaatacacgaggat
accatctggaatgttgaggagcatcgctacacacagactgaagaccatcgggagcgagag
cgccagatgctaacagccgaaatgatacccacaaagcggacgcacatctcgttctgggcc
aagttactggagctccagtccaagatgctgttccaagcgaagtcagtgccaagtcacatg
tacagctcgatgccgcacgagtggccgctgatggacaagggcatcgcctactggttggat
tcaaagtccagtgcgcagatctatttgctgggaaacgtactcatctggtacacagccacc
acgggaatacttgtctacgccggactactggccttctacgctatgcggcggcaacgactt
tgcttcgatatttcggagcaggagtggcagcgattcatcattgccggtgataccttcttt
atgggctacgtgatgcactatctgccgtacttttgtgtggatcgtacacttttcctgcac
aattacttgccagcctttgtgtttaagctacttctattgtgctttgttgcggatcatctg
gactatctgctcagacgcttctgcaccgggcgtggtgtccacttggtgcgcctgtatcgc
ctaatgctaatcctgtggttggtgggcgtgctcagcattttctcgaagtttattccattc
agttatggtgcgaaaaaaatgaccttaaatgaggttcgcaatcttcgatggaaggatacc
tgggactttgttctgcacaaaaaccaccacctgcactga

DBGET integrated database retrieval system