KEGG   Drosophila yakuba: Dyak_GE20389Help
Entry
Dyak_GE20389      CDS       T01068                                 

Definition
GE20389 gene product from transcript GE20389-RA
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dyak_GE20389
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE20389
Transcription factors [BR:dya03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dyak_GE20389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 525 aa AA seqDB search
MLESLDGFMMVFSSMGSIFYASESITSQLGYLPQDLYNMTIYDLAYEMDHEALLNIFLNP
TPVIEPRQTDISSSNQITFYTHLKRGGMEKVDANAYELVKFVGYFRNDTNTSTPTSAEAS
NGSNGQPAVLPRIFQQHSNAEVDKKLVFVGTGRVQNPQLIREMSIIDPTSNEFTSKHSME
WKFLFLDHRAPPIIGYMPFEVLGTSGYDYYHFDDLDSIVACHEELRQTGEGKSCYYRFLT
KGQQWIWLQTDYYVSYHQFNSKPDYVVCTHKVVSYAEVLKDCRKDGQKSGNSSSSTTNNG
SSKVIASAGTSSKSASATTTLRDFELSSQNLDGTLLGNSLASLGNETAATSPAVDSSPMW
SASAVQPSGSCQINPLKTSRPASSYGNISSTGISPKAKRKCYFYNNRGNDSDSTSMSTDS
VTSRQSLMTHVSSQSQRQRSHHHRENHHSQSHHHMQQQQQQQQQQQQQQQQQQSNNFFSS
NPFLNSQNQNQNQLPNDLEILPYQMSQEQSQNLFNSPHTAPGSSQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctggagtccctcgatggtttcatgatggtcttcagcagcatgggctccatcttctac
gcctcggaaagtattacctcccagctgggttatctgccgcaagatttgtacaacatgacc
atatacgacctggcctacgagatggaccacgaggcgctgctgaacatcttcctgaatccc
acgccggtaatcgagcccagacagacggacatcagttccagcaaccagatcaccttctac
acccatttgaaacgcggcggcatggagaaagtggatgccaatgcctacgagttggtcaaa
ttcgtgggctactttcgtaacgataccaacacctcgacgcccaccagtgcagaggcatcg
aatggctcaaatggacaacctgcggtgctgccgcgcatcttccagcagcactccaatgcc
gaggtggacaagaagctggttttcgtgggcacgggacgcgtacagaatccgcagctgatc
agggaaatgagcatcatcgatcccaccagtaatgagttcacctcgaagcacagcatggag
tggaagtttctgtttctggatcaccgagcaccgccgatcattggatatatgccctttgag
gttctgggcacttccggctatgattactaccacttcgatgacctggacagcattgtggcg
tgccatgaagagctgaggcaaacgggtgagggcaagtcctgctactacagattcctcacg
aagggccagcagtggatatggctgcaaacggactactatgtgagctaccaccagttcaac
tccaagccggactacgtggtctgcacccacaaggtggtcagctatgccgaggttctcaag
gattgtcgcaaggatggccaaaagtccggcaatagcagcagcagcaccaccaacaatggc
agcagcaaagtcattgcctccgcgggaaccagcagcaaatccgcatctgccaccacaaca
ctgagggacttcgagctgagcagccagaatctggatggcacattgctgggcaatagtctc
gccagtttgggcaatgaaacggcagccacctcacccgccgtcgactcatcgcccatgtgg
tccgcctcggcggtccaaccgtctggttcctgccaaataaatccgctgaagacatcgcgt
cccgcctcaagttatgggaatatcagttccacaggcatttcgccgaaggccaagcgaaag
tgctacttctacaacaaccggggaaatgactcggattccacgtccatgtccacggattcg
gtcaccagtcggcagtccctaatgacgcacgtcagttcgcaaagccaacggcagcgatcg
catcaccatcgagaaaatcatcacagtcagtcacatcatcacatgcagcaacaacagcag
cagcagcagcaacaacagcagcagcagcagcaacagcaatcaaacaactttttcagttcg
aatccctttctcaacagtcagaatcagaaccaaaatcagttgccaaacgatctggaaata
ttgccataccagatgtcccaagagcaatcacagaatctattcaactcgccacacacagca
ccgggcagtagtcaatag

DBGET integrated database retrieval system