KEGG   Drosophila yakuba: Dyak_GE20389Help
Entry
Dyak_GE20389      CDS       T01068                                 

Gene name
dyak_GLEANR_4230
Definition
(RefSeq) GE20389 gene product from transcript GE20389-RB
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Pathway
Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 Organismal Systems
  Environmental adaptation
   04711 Circadian rhythm - fly
    Dyak_GE20389 (dyak_GLEANR_4230)
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE20389 (dyak_GLEANR_4230)
Transcription factors [BR:dya03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    Dyak_GE20389 (dyak_GLEANR_4230)
Chromosome [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Dyak_GE20389 (dyak_GLEANR_4230)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 1067 aa AA seqDB search
MDDESDDKDDTKRKSRNLSEKKRRDQFNSLVNDLSALISTSSRKMDKSTVLKSTIAFLKN
HNEATDRSKVFEIQQDWKPAFLSNDEYTHLMLESLDGFMMVFSSMGSIFYASESITSQLG
YLPQDLYNMTIYDLAYEMDHEALLNIFLNPTPVIEPRQTDISSSNQITFYTHLKRGGMEK
VDANAYELVKFVGYFRNDTNTSTPTSAEASNGSNGQPAVLPRIFQQHSNAEVDKKLVFVG
TGRVQNPQLIREMSIIDPTSNEFTSKHSMEWKFLFLDHRAPPIIGYMPFEVLGTSGYDYY
HFDDLDSIVACHEELRQTGEGKSCYYRFLTKGQQWIWLQTDYYVSYHQFNSKPDYVVCTH
KVVSYAEVLKDCRKDGQKSGNSSSSTTNNGSSKVIASAGTSSKSASATTTLRDFELSSQN
LDGTLLGNSLASLGNETAATSPAVDSSPMWSASAVQPSGSCQINPLKTSRPASSYGNISS
TGISPKAKRKCYFYNNRGNDSDSTSMSTDSVTSRQSLMTHVSSQSQRQRSHHHRENHHSQ
SHHHMQQQQQQQQQQQQQQQQQQQQQHQNPPQQHQQQQQQQLQQQLQHTVGTQKMVPLLP
LAPTQIMTGNSCQFPQPAYPLASPQLVAPTFLEPPQYLTAIPMQPVIAPFPVAPVLSPLA
QPQPDMLPDTVVMTPTQSQLQDQLQRKHDELQKLIMQQQNELRIVSEQLLLSRYTYLQPM
MSMGFAPGNMTASAVGNLGAGGQRGMNFSSSNAVQPQFNQYGFALNSEQMLNQQDQQMMM
QQQQNLHTQHQHNLQAQHQSHSQLQQHSQQQSQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQQQLQLQQQNDILLREDIDDIDAFLNLSPLHSLGSQSAINPFNSGS
NNNNQSFNGGGNQNNGNQSSNNNRSTNPPQNNNEDSLLSYMQMATESSPSINFHMGISDD
GSETQSEDNKMMHTSNSNLVQQQQQQQQQQQQQQQQQQQQQQQQQQILQQQQQQQSNNFF
SSNPFLNSQNQNQNQLPNDLEILPYQMSQEQSQNLFNSPHTAPGSSQ
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgagagcgacgacaaggatgatacaaaaaggaaatcgcgtaatctcagcgag
aagaagcggcgggatcagttcaactcgctggtcaacgatctgagcgccctcatatccacc
tccagtcgaaagatggacaagtccacggtgctcaagtccacgattgccttcctgaagaat
cataatgaggccaccgatcgctccaaggttttcgaaatacaacaggactggaagcccgcg
ttcctcagcaacgatgagtacactcatctcatgctggagtccctcgatggtttcatgatg
gtcttcagcagcatgggctccatcttctacgcctcggaaagtattacctcccagctgggt
tatctgccgcaagatttgtacaacatgaccatatacgacctggcctacgagatggaccac
gaggcgctgctgaacatcttcctgaatcccacgccggtaatcgagcccagacagacggac
atcagttccagcaaccagatcaccttctacacccatttgaaacgcggcggcatggagaaa
gtggatgccaatgcctacgagttggtcaaattcgtgggctactttcgtaacgataccaac
acctcgacgcccaccagtgcagaggcatcgaatggctcaaatggacaacctgcggtgctg
ccgcgcatcttccagcagcactccaatgccgaggtggacaagaagctggttttcgtgggc
acgggacgcgtacagaatccgcagctgatcagggaaatgagcatcatcgatcccaccagt
aatgagttcacctcgaagcacagcatggagtggaagtttctgtttctggatcaccgagca
ccgccgatcattggatatatgccctttgaggttctgggcacttccggctatgattactac
cacttcgatgacctggacagcattgtggcgtgccatgaagagctgaggcaaacgggtgag
ggcaagtcctgctactacagattcctcacgaagggccagcagtggatatggctgcaaacg
gactactatgtgagctaccaccagttcaactccaagccggactacgtggtctgcacccac
aaggtggtcagctatgccgaggttctcaaggattgtcgcaaggatggccaaaagtccggc
aatagcagcagcagcaccaccaacaatggcagcagcaaagtcattgcctccgcgggaacc
agcagcaaatccgcatctgccaccacaacactgagggacttcgagctgagcagccagaat
ctggatggcacattgctgggcaatagtctcgccagtttgggcaatgaaacggcagccacc
tcacccgccgtcgactcatcgcccatgtggtccgcctcggcggtccaaccgtctggttcc
tgccaaataaatccgctgaagacatcgcgtcccgcctcaagttatgggaatatcagttcc
acaggcatttcgccgaaggccaagcgaaagtgctacttctacaacaaccggggaaatgac
tcggattccacgtccatgtccacggattcggtcaccagtcggcagtccctaatgacgcac
gtcagttcgcaaagccaacggcagcgatcgcatcaccatcgagaaaatcatcacagtcag
tcacatcatcacatgcagcaacaacagcagcagcagcagcaacaacagcagcaacaacaa
cagcagcaacagcagcagcatcagaatccgccgcagcaacatcagcaacagcagcagcag
caactgcagcagcagctgcaacatacagtgggcactcaaaaaatggtgcccctcctgccg
cttgcgcccacgcaaattatgactggaaattcgtgtcagttcccgcaacccgcctatccg
ctggctagtccccaactggtggcacccacatttctggagccgccacaatatctcaccgcc
attcccatgcaaccagtgatcgctccgtttccggtggcgccagttctttcgccactggcg
caaccacaaccggatatgctgcccgacacggtggtgatgacgccaacgcagagtcagttg
caggatcagctgcagcgtaagcacgacgagctgcaaaagctgatcatgcagcagcagaat
gagctgaggatcgtctcggagcagctgctcctctcccgctacacatatctgcagcccatg
atgtcgatgggtttcgcaccgggcaacatgacagcatcagcggtgggcaatttgggtgca
ggtggccagcggggcatgaacttcagcagcagcaatgcagtgcagccgcagttcaatcag
tatggcttcgcgctgaactcggagcagatgctcaaccagcaggatcagcagatgatgatg
cagcagcagcagaatctgcacacgcagcaccagcacaatctgcaggcgcagcatcagagc
cactcgcagttgcagcaacacagtcagcagcaaagtcagcagcagcaacagcagcagcag
caacaacagcaacagcagcagcagcagcaacagcaacagcagcagcagcaacaacagcaa
cagcagcaacagcagcaacagcagcaacaacaacagcagcaacagcagcagttacagctg
cagcaacaaaatgatatcttactgcgcgaggacatcgatgatatagacgccttcctcaat
ctatcaccgctgcactcgctgggctcgcaatccgccatcaatccctttaactccggcagc
aataacaacaatcaaagcttcaatggcggcggtaatcagaataatggcaaccagagtagc
aacaacaatcgcagtacaaatcccccgcaaaataacaatgaggactctctgttgtcctac
atgcaaatggccaccgaatcgagtccttcgatcaactttcacatgggcatcagcgatgat
ggctccgaaacgcagagcgaggacaacaagatgatgcacacttccaacagcaatctggtg
cagcagcagcagcaacagcagcagcaacaacagcagcagcaacaacagcagcagcaacaa
caacagcagcagcagcaaatcctgcagcagcagcagcaacagcaatcaaacaactttttc
agttcgaatccctttctcaacagtcagaatcagaaccaaaatcagttgccaaacgatctg
gaaatattgccataccagatgtcccaagagcaatcacagaatctattcaactcgccacac
acagcaccgggcagtagtcaatag

DBGET integrated database retrieval system