KEGG   Drosophila yakuba: Dyak_GE20856Help
Entry
Dyak_GE20856      CDS       T01068                                 

Gene name
Dyak_LanB2
Definition
Laminin B2
Orthology
K05635  
laminin, gamma 1
Organism
dya  Drosophila yakuba
Pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:dya04512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 1639 aa AA seqDB search
MKRSRWSHSGSSTARLLLIGVLFASCSTAILGAQRPPINSAGGHELRGTTFMPALECYDP
YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQTMNQNHKNCEFCKYNDHNPSFLT
DLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTS
ETGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEG
RPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAVGARCK
CNGHASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACN
CNGLADKCFFDAALFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCINCACDPVG
SRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDIGGSQQNTPACDTDTG
ICFCKDNVEGRRCNECKPGFFNLDKTNRFGCTPCFCYGHTSECMTAPGYSIVSVTSNFNK
FKERWTAADLNQREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKL
QLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSA
RGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQF
CESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYG
NALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFYGDPTGLLGD
VQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCD
RCSCYDAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDP
VGSYNSTCDRYSGQCHCRPGVMGQRCDQCENFFYGFSSEGCKPCECDESGSKGFQCDQNG
QCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLFNLSQTLDEIAR
TPVTNDDEFEAKLKAVQEKVGILAQDARDNSGEGGQTYAEVIDDLHKHLDSVREHLASAD
KFQADANAEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALAKAKEKSVEFGQQS
EQISDISREARALADKLESEAQFDLKNAKDATDAVEKAHQLAKSAIDLQLKIGTELRYEV
GLEVSQVKQSLGVVVQTSKEALRKANEVYDTALTLLNEVNRQTQPEIDISQLKKDAVAAN
ERADELLKQITELSNSNGELFADFESEQELTEALLKRAEQQQLEDTELLERAKAAHDKAT
KAVEQGDNTLKEANNTYEKLAGFQSDVQRSSESAEKALQTVPNIEKEIQNAESLISQAEE
ALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLRAEADQLNHRVK
LTEMDIVGLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANDELTAIKDELENLKD
INTGDLDKLENRLATVEGEINRVNLTGRIEKYREQRTIQKNLIDKYDAELRELKDEVLNI
GLISKALPDSCFSRNRLEP
NT seq 4920 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagccggtggagccacagtggctcctccacggctcgtctcctgctgatcgga
gtcctgttcgccagctgttccaccgccatcctgggcgcccagcgtccgcccatcaactcc
gccggaggtcacgagctgcgcggaaccaccttcatgccggccctggagtgctacgatcca
tacggcagaccgcagaaatgtctgccagaatttatcaacgctgcctatcaactgcaaatt
gagtccactaacacctgtggtgagcagaacgacaaccacttctgcatacaaaccatgaac
caaaaccacaagaactgcgagttttgcaagtacaatgatcacaatccatccttcttgacg
gacttgcatgatccgcaaagtcccacctggtggcagtcggagaccatgttcgagggcatt
cagcacccgaactacgtgaatctgactctgcaccttggaaaatcctatgacatcacctac
gtgcgcattctcttccgctcgccacgacccgaatcctttacgatttacaagaggacctcg
gagactggaccctggattccctaccagttctacagtgccacctgtcgcgacacctactcc
ctgccagactcgcgagccattcgcaagggggagggcgaggcgcatgcgctgtgtaccagc
gagtacagtgatatctcgccgttgagggacggtgagattgccttctccacgctggagggt
cggcccagtggcatcaatttcgagcgcagtggagagctgcaggagtgggtcacggccacg
gatatccgcattaccctggaccgcctgaacacgttcggtgatgagctcttcggtgattcc
caggtgctcaagtcgtacttctatgccatcagcgacattgccgtgggcgcccgttgcaag
tgcaatggacatgccagcaagtgtgtcgcgagcacgggaatgcatggcgagaggactctg
gtctgcgagtgccggcacaacactgatggacccgattgcgaccgctgtctgccgctctac
aacgacctcaagtggaagaggtccacctcgacggaggtgaacgagtgcaaagcttgcaac
tgcaatggattggcggacaagtgcttcttcgacgctgcgctgttcaaccggacgggtcat
ggaggtcactgcctggactgccgagagaatcgcgatggacccaactgcgaacgctgcaag
gagaacttctacatgcgcgacgatggctactgcatcaactgcgcctgcgatcccgtgggc
tccagatcgctgcagtgcaacagtcacggcaagtgccaatgcaaaccgggagtgactggc
gacaagtgcgaccgctgcgacaacaactactaccaatttggaccccatggatgccagcag
tgcggatgcgacattggtggatcccagcagaacactcccgcctgcgataccgacaccgga
atctgtttctgcaaggataatgtggagggcagacgctgcaatgaatgcaaaccgggcttc
ttcaatctggacaagaccaatcggtttggctgcaccccgtgcttctgctatggtcacacc
tccgagtgcatgactgcaccaggatactcaatcgtctcggtcacctccaatttcaacaag
ttcaaggaacgctggacggccgccgatttgaaccaacgcgaggtggacatcaagtacaac
cagtacagtcggagcattggaaccaccgcccagggcaacgagcacgtctacttccaggcg
ccggatcgcttcctcggcgatcagcgtgcctcctacaacagggatctgaagttcaagctg
cagctagttggtcaggtggccaataccggagtcagtgatgtgatcttagagggtgctggc
agccgcatctcgctgcccatcttcgcccagggcaacggaatacccgaccagggagtcaag
gaatataccttccggctgcacgaacatcatgactaccagtggcagcccagccagtcggct
cgtggattcctttcgattctgtccaatctgacggccattaagatcagggccacgtactcg
gtgcagggtgaggccatcctggatgatgtcgagctgcagacggcacatcgtggagccgcc
ggtcatccggccacctggatcgagcagtgtacctgtccggagggctacctgggccagttc
tgtgagtcctgtgctcccggctatcgccacagtcctgcgcgcggtggtcccttcatgccc
tgcataccctgtgattgccatggccatgctgacatctgtgactcggagacgggcaggtgc
atctgccagcacaacacccacggagataactgcgatcagtgcgccaagggattctacgga
aatgccctgggcggaactcccaacgactgcaagcgttgtccctgtcccaatgatggtgcc
tgcctgcagatcaacgaagacacggtcatctgtacggagtgcccgaagggttacttcggt
tcccgttgcgagcagtgtagcgatggcttctacggagatcccactggtctcttgggcgat
gtgcagacgtgcaagagctgcgactgcaatggcaacgtggatcccaacgccgtgggcaat
tgcaaccggactacgggcgagtgcttaaagtgcatccacaacacagccggagagcactgt
gatcagtgtttgtcaggtcactttggcgatcccctggccttgccccatggacgctgtgac
cgctgtagttgctacgacgctggaacggagcaggatgaacagagtatcacgcgatgcgac
caagtcaccggtcagtgccagtgcaaaccgaatgtgattggaagggattgcggagagtgc
cagccgggctacttcaacatccgatcgggcaatggctgcgagaactgcctgtgcgatccg
gtgggcagctacaactccacctgcgatcgctactcgggccagtgtcactgccgaccgggt
gtgatgggtcagcggtgcgatcagtgcgagaacttcttctacggattctccagcgagggc
tgcaagccatgcgaatgcgacgagagcggctccaagggattccagtgcgaccagaatggc
cagtgtccgtgcaatgacaacgtggagggacgtcgctgcgatcgctgcaaggagaacaag
tacgacaggcatcggggttgcatcgattgccccgattgctataacctcgtgcaagatgcc
gccgatttgcatcgtgccaagctattcaatctcagtcaaacgctggacgagattgcccgc
accccggtgaccaatgacgacgagttcgaggccaagttgaaggcggtgcaggagaaggtg
ggtatcttggcccaggacgcccgcgataattccggcgaaggtggtcagacctacgcagag
gtcatcgatgatcttcacaagcacctggacagcgtgagggagcacctggcgagtgcggat
aagttccaggctgatgccaatgcggagatcgacagggcgcgtcagaactacaccattctg
gaccagatcaccgagaacgccaagaaggaactgcagcaggcactcgacctcctgaacgac
gaaggtgcccaggcattggccaaggccaaggagaagtctgtggagtttggacagcaatcg
gaacagatctcggacatctctcgggaggctcgagccctggccgacaaactggagtcggag
gcccagttcgatttgaagaacgccaaggatgccacggatgcggtggagaaggcccatcag
ctggccaagagtgccatcgatttgcagcttaagatcggcactgagctgcgttacgaggtt
ggcttggaggtgagccaggtgaagcaatccctgggcgtcgtggtgcagacctccaaggag
gctcttcgcaaagccaacgaggtctacgatacagcattgaccctgctcaatgaagtgaat
cgtcaaacccaaccggaaatcgatatcagccagttgaagaaggacgcagtggcggccaat
gaacgagctgatgagctgctcaagcagattactgagttgtccaacagcaacggcgagcta
tttgcggatttcgaatcggagcaagaactgacggaggcgctgcttaagagagctgagcag
cagcaactggaggacaccgagctgctggagcgagccaaggccgcccacgacaaggccacc
aaggcagtggagcagggcgacaataccctaaaggaggccaacaatacctacgagaagttg
gccggcttccagtcggatgtccagcgctcttctgagagtgcggagaaagccctgcagacg
gtgcccaacatcgagaaggagatccagaatgcggagagcctgatcagccaggcggaggag
gcgctcgatggagccaataagaatgccaacgaggccaagaagaatgcccaggaggcgcag
ctaaagtacgccgaacaagcttccaaggatgctgagctaatccgccgcaaggccaacgag
accaaggtggctgcacgcaatctgcgcgctgaggccgaccaactgaatcaccgtgtgaaa
ctcaccgaaatggacatcgtcggactggaggagagctcgaccaaggacgacaacctggtg
gatgatgccaagcgaaaggtgggccaggccaaggccgatacccaggaggcccagaagcag
atcgagaaggccaatgatgagctgacggccatcaaggatgagctggagaacctgaaggac
atcaacacgggcgatttggataaattggagaatcgtttggccactgtggagggtgagatc
aatcgcgtcaacctgacgggacgaatcgaaaagtatcgggaacagcgcaccatacagaag
aatctgatcgacaagtacgatgccgagctgagggaactcaaggatgaagtcctgaatatt
ggactgatttccaaggccctgcccgatagctgcttcagtcgcaatcgcctcgaaccctag

DBGET integrated database retrieval system