KEGG   Drosophila yakuba: Dyak_GE20856Help
Entry
Dyak_GE20856      CDS       T01068                                 

Gene name
Dyak_LanB2
Definition
(RefSeq) laminin B2
  KO
K05635  laminin, gamma 1
Organism
dya  Drosophila yakuba
Pathway
dya04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dyak_GE20856 (Dyak_LanB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 6532531
NCBI-ProteinID: XP_002093277
FlyBase: FBpp0265866 FBgn0068131
UniProt: B4PEF1
Position
3L
AA seq 1639 aa AA seqDB search
MKRSRWSHSGSSTARLLLIGVLFASCSTAILGAQRPPINSAGGHELRGTTFMPALECYDP
YGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQTMNQNHKNCEFCKYNDHNPSFLT
DLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTS
ETGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEG
RPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYFYAISDIAVGARCK
CNGHASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACN
CNGLADKCFFDAALFNRTGHGGHCLDCRENRDGPNCERCKENFYMRDDGYCINCACDPVG
SRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDIGGSQQNTPACDTDTG
ICFCKDNVEGRRCNECKPGFFNLDKTNRFGCTPCFCYGHTSECMTAPGYSIVSVTSNFNK
FKERWTAADLNQREVDIKYNQYSRSIGTTAQGNEHVYFQAPDRFLGDQRASYNRDLKFKL
QLVGQVANTGVSDVILEGAGSRISLPIFAQGNGIPDQGVKEYTFRLHEHHDYQWQPSQSA
RGFLSILSNLTAIKIRATYSVQGEAILDDVELQTAHRGAAGHPATWIEQCTCPEGYLGQF
CESCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYG
NALGGTPNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSRCEQCSDGFYGDPTGLLGD
VQTCKSCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCD
RCSCYDAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDP
VGSYNSTCDRYSGQCHCRPGVMGQRCDQCENFFYGFSSEGCKPCECDESGSKGFQCDQNG
QCPCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAADLHRAKLFNLSQTLDEIAR
TPVTNDDEFEAKLKAVQEKVGILAQDARDNSGEGGQTYAEVIDDLHKHLDSVREHLASAD
KFQADANAEIDRARQNYTILDQITENAKKELQQALDLLNDEGAQALAKAKEKSVEFGQQS
EQISDISREARALADKLESEAQFDLKNAKDATDAVEKAHQLAKSAIDLQLKIGTELRYEV
GLEVSQVKQSLGVVVQTSKEALRKANEVYDTALTLLNEVNRQTQPEIDISQLKKDAVAAN
ERADELLKQITELSNSNGELFADFESEQELTEALLKRAEQQQLEDTELLERAKAAHDKAT
KAVEQGDNTLKEANNTYEKLAGFQSDVQRSSESAEKALQTVPNIEKEIQNAESLISQAEE
ALDGANKNANEAKKNAQEAQLKYAEQASKDAELIRRKANETKVAARNLRAEADQLNHRVK
LTEMDIVGLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANDELTAIKDELENLKD
INTGDLDKLENRLATVEGEINRVNLTGRIEKYREQRTIQKNLIDKYDAELRELKDEVLNI
GLISKALPDSCFSRNRLEP
NT seq 4920 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagccggtggagccacagtggctcctccacggctcgtctcctgctgatcgga
gtcctgttcgccagctgttccaccgccatcctgggcgcccagcgtccgcccatcaactcc
gccggaggtcacgagctgcgcggaaccaccttcatgccggccctggagtgctacgatcca
tacggcagaccgcagaaatgtctgccagaatttatcaacgctgcctatcaactgcaaatt
gagtccactaacacctgtggtgagcagaacgacaaccacttctgcatacaaaccatgaac
caaaaccacaagaactgcgagttttgcaagtacaatgatcacaatccatccttcttgacg
gacttgcatgatccgcaaagtcccacctggtggcagtcggagaccatgttcgagggcatt
cagcacccgaactacgtgaatctgactctgcaccttggaaaatcctatgacatcacctac
gtgcgcattctcttccgctcgccacgacccgaatcctttacgatttacaagaggacctcg
gagactggaccctggattccctaccagttctacagtgccacctgtcgcgacacctactcc
ctgccagactcgcgagccattcgcaagggggagggcgaggcgcatgcgctgtgtaccagc
gagtacagtgatatctcgccgttgagggacggtgagattgccttctccacgctggagggt
cggcccagtggcatcaatttcgagcgcagtggagagctgcaggagtgggtcacggccacg
gatatccgcattaccctggaccgcctgaacacgttcggtgatgagctcttcggtgattcc
caggtgctcaagtcgtacttctatgccatcagcgacattgccgtgggcgcccgttgcaag
tgcaatggacatgccagcaagtgtgtcgcgagcacgggaatgcatggcgagaggactctg
gtctgcgagtgccggcacaacactgatggacccgattgcgaccgctgtctgccgctctac
aacgacctcaagtggaagaggtccacctcgacggaggtgaacgagtgcaaagcttgcaac
tgcaatggattggcggacaagtgcttcttcgacgctgcgctgttcaaccggacgggtcat
ggaggtcactgcctggactgccgagagaatcgcgatggacccaactgcgaacgctgcaag
gagaacttctacatgcgcgacgatggctactgcatcaactgcgcctgcgatcccgtgggc
tccagatcgctgcagtgcaacagtcacggcaagtgccaatgcaaaccgggagtgactggc
gacaagtgcgaccgctgcgacaacaactactaccaatttggaccccatggatgccagcag
tgcggatgcgacattggtggatcccagcagaacactcccgcctgcgataccgacaccgga
atctgtttctgcaaggataatgtggagggcagacgctgcaatgaatgcaaaccgggcttc
ttcaatctggacaagaccaatcggtttggctgcaccccgtgcttctgctatggtcacacc
tccgagtgcatgactgcaccaggatactcaatcgtctcggtcacctccaatttcaacaag
ttcaaggaacgctggacggccgccgatttgaaccaacgcgaggtggacatcaagtacaac
cagtacagtcggagcattggaaccaccgcccagggcaacgagcacgtctacttccaggcg
ccggatcgcttcctcggcgatcagcgtgcctcctacaacagggatctgaagttcaagctg
cagctagttggtcaggtggccaataccggagtcagtgatgtgatcttagagggtgctggc
agccgcatctcgctgcccatcttcgcccagggcaacggaatacccgaccagggagtcaag
gaatataccttccggctgcacgaacatcatgactaccagtggcagcccagccagtcggct
cgtggattcctttcgattctgtccaatctgacggccattaagatcagggccacgtactcg
gtgcagggtgaggccatcctggatgatgtcgagctgcagacggcacatcgtggagccgcc
ggtcatccggccacctggatcgagcagtgtacctgtccggagggctacctgggccagttc
tgtgagtcctgtgctcccggctatcgccacagtcctgcgcgcggtggtcccttcatgccc
tgcataccctgtgattgccatggccatgctgacatctgtgactcggagacgggcaggtgc
atctgccagcacaacacccacggagataactgcgatcagtgcgccaagggattctacgga
aatgccctgggcggaactcccaacgactgcaagcgttgtccctgtcccaatgatggtgcc
tgcctgcagatcaacgaagacacggtcatctgtacggagtgcccgaagggttacttcggt
tcccgttgcgagcagtgtagcgatggcttctacggagatcccactggtctcttgggcgat
gtgcagacgtgcaagagctgcgactgcaatggcaacgtggatcccaacgccgtgggcaat
tgcaaccggactacgggcgagtgcttaaagtgcatccacaacacagccggagagcactgt
gatcagtgtttgtcaggtcactttggcgatcccctggccttgccccatggacgctgtgac
cgctgtagttgctacgacgctggaacggagcaggatgaacagagtatcacgcgatgcgac
caagtcaccggtcagtgccagtgcaaaccgaatgtgattggaagggattgcggagagtgc
cagccgggctacttcaacatccgatcgggcaatggctgcgagaactgcctgtgcgatccg
gtgggcagctacaactccacctgcgatcgctactcgggccagtgtcactgccgaccgggt
gtgatgggtcagcggtgcgatcagtgcgagaacttcttctacggattctccagcgagggc
tgcaagccatgcgaatgcgacgagagcggctccaagggattccagtgcgaccagaatggc
cagtgtccgtgcaatgacaacgtggagggacgtcgctgcgatcgctgcaaggagaacaag
tacgacaggcatcggggttgcatcgattgccccgattgctataacctcgtgcaagatgcc
gccgatttgcatcgtgccaagctattcaatctcagtcaaacgctggacgagattgcccgc
accccggtgaccaatgacgacgagttcgaggccaagttgaaggcggtgcaggagaaggtg
ggtatcttggcccaggacgcccgcgataattccggcgaaggtggtcagacctacgcagag
gtcatcgatgatcttcacaagcacctggacagcgtgagggagcacctggcgagtgcggat
aagttccaggctgatgccaatgcggagatcgacagggcgcgtcagaactacaccattctg
gaccagatcaccgagaacgccaagaaggaactgcagcaggcactcgacctcctgaacgac
gaaggtgcccaggcattggccaaggccaaggagaagtctgtggagtttggacagcaatcg
gaacagatctcggacatctctcgggaggctcgagccctggccgacaaactggagtcggag
gcccagttcgatttgaagaacgccaaggatgccacggatgcggtggagaaggcccatcag
ctggccaagagtgccatcgatttgcagcttaagatcggcactgagctgcgttacgaggtt
ggcttggaggtgagccaggtgaagcaatccctgggcgtcgtggtgcagacctccaaggag
gctcttcgcaaagccaacgaggtctacgatacagcattgaccctgctcaatgaagtgaat
cgtcaaacccaaccggaaatcgatatcagccagttgaagaaggacgcagtggcggccaat
gaacgagctgatgagctgctcaagcagattactgagttgtccaacagcaacggcgagcta
tttgcggatttcgaatcggagcaagaactgacggaggcgctgcttaagagagctgagcag
cagcaactggaggacaccgagctgctggagcgagccaaggccgcccacgacaaggccacc
aaggcagtggagcagggcgacaataccctaaaggaggccaacaatacctacgagaagttg
gccggcttccagtcggatgtccagcgctcttctgagagtgcggagaaagccctgcagacg
gtgcccaacatcgagaaggagatccagaatgcggagagcctgatcagccaggcggaggag
gcgctcgatggagccaataagaatgccaacgaggccaagaagaatgcccaggaggcgcag
ctaaagtacgccgaacaagcttccaaggatgctgagctaatccgccgcaaggccaacgag
accaaggtggctgcacgcaatctgcgcgctgaggccgaccaactgaatcaccgtgtgaaa
ctcaccgaaatggacatcgtcggactggaggagagctcgaccaaggacgacaacctggtg
gatgatgccaagcgaaaggtgggccaggccaaggccgatacccaggaggcccagaagcag
atcgagaaggccaatgatgagctgacggccatcaaggatgagctggagaacctgaaggac
atcaacacgggcgatttggataaattggagaatcgtttggccactgtggagggtgagatc
aatcgcgtcaacctgacgggacgaatcgaaaagtatcgggaacagcgcaccatacagaag
aatctgatcgacaagtacgatgccgagctgagggaactcaaggatgaagtcctgaatatt
ggactgatttccaaggccctgcccgatagctgcttcagtcgcaatcgcctcgaaccctag

DBGET integrated database retrieval system