KEGG   Drosophila yakuba: Dyak_GE20976Help
Entry
Dyak_GE20976      CDS       T01068                                 

Definition
GE20976 gene product from transcript GE20976-RA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Dyak_GE20976
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE20976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 141 aa AA seqDB search
MRALLVICALALAAVATHARTMDRCSLARELSNLGVPRDQLAKWTCIAQHESSYRTGVVG
PANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDISNSVRCAQKIQRQQG
WTAWSTWKYCSGSLPSINSCF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagagctctccttgtgatttgtgccctggctctggcggcagtcgccacccacgcccga
acgatggatagatgttccctggccagggagttgtccaacctgggcgttccccgcgaccag
ctggccaagtggacctgcatcgcccagcacgagagttcctaccgcaccggcgtcgttggt
cccgccaactccaatggatccaatgactacggcatctttcagatcaacaacaagtactgg
tgcaaacccgccgacggtcgcttctcctacaacgagtgcggattgagctgtaatgccctt
ctgaccgacgacatcagcaactccgtgaggtgcgcccagaagattcagcggcagcaggga
tggacggcctggtccacctggaagtactgcagcggatccctgccctcgatcaacagttgc
ttctag

DBGET integrated database retrieval system