KEGG   Drosophila yakuba: Dyak_GE21106Help
Entry
Dyak_GE21106      CDS       T01068                                 

Definition
GE21106 gene product from transcript GE21106-RA
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 1513 aa AA seqDB search
MASTSTSASTTAGSSGAAGGGAATPISTPSTPQPSGVSSGPSNNVNNNNNNLVSPSGNNN
LMTPVQAFTPTGQPVYNPPVYMSAHGGHPHAGAHYPAMIPAPMPSNHVYVNNVTANVNLH
GWPHGVPAYMPPGGQHHYIGHGDMPQEQGNTVMPHLQPVPISLAPQGGSPNPHVPRMGGG
RTRERGRPRGGGPRRNDYHGPRHLQQQQQQLITLPPQQQMPPPDGANPGLQLQPDQMGQQ
LAPPEAHMQHLQQYYAAAPPTYAYGPYPSPYFTPQHANLQPPPNATAAQQATGTPLFISG
PVMYNPAWFNHGGYIYPMMHPAEYQYVPEDAGQPGVDERGAQPDGGMTPIWHQGPMYAED
FEVLQQQQQQVAVHPNGGAVSVADELNHNSSSLPSSETSSMLSPNYPIYDPQMHEMQHQM
GVMQIYDDGQMAALQPIHPGAGPLPQYEDELAECGAPPPGAIPVAWTAAMPLPPDGVQPA
LLPPPHHILQQTSPMLIEQPAQLVQAQPPQPPTPTPQQQQQQQPHQEQAVDKSLTKNNNE
VVALDEKLANEKQQQIELEFRQQQQEQLQQQQQQQHHHQQPQQQQAEEQQQQTEKPPTKV
PNLVVATVAPQLQQPPPQQQHQSASQQHQQQQTSPVVVPPQQQQQQQQPAQQTSYHDQHH
LPQQQQTQQPQQQRKPSQQYNQSQQQQVRRKYSSEYNHHHHQHGSSDTGIQTTKTMSWTN
SAQHKKSTQSVSVTASPNNVNNGPAVGAASGPAGKTNYSHTTKTFTNQQHYQQQHYHTQN
TYNNNSNSGGSSSNSSASSSNNQPQVRNYGTMKVPSSPVASTAPTLERKNSQQTAATPAA
AAAAAPVAIATATTSTASITANPNQFQPESGNSGASPAVAAPQQQQPAAQQHAAQAAAAP
SKSYSSYASKKHQSYEPVVLSSVVATSSSASSSQPQLNLAPPAPPASQSSSDSSQLSWAS
LFASNKPVAKVAPYEASKIAQQQQQPSHPVLQLAPPQPAQVAAAAPVAQLASPPQNVPLP
TAHQQSQLPAPVPAPTAPLVTPGTLSYSAASAQAVPAPSPASASVKPLKAEPPRPVQQQL
DEWTNKYAEYLTRHKTNLAAISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRSIPKQ
AAVLSEVKTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGAQSKGKDEFVGSDLQCDMAFE
PTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNGQEPAEP
EDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRLQREGEHSTDVIQPFFTLQ
LNIEKAASVKEALEILVGRDQLEGVTGSKTKQEVVAWQQMTLEKLPVVLILHLKYFDYRS
DGCTKILKKVEFPVELKIDAKILGSKKTSQKQRAYRLFAVVYHDGKEASKGHYITDVFHT
GYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYYRRSDTLPPQQQQSQQQNGGGSGGVV
GSSSSSSNAGDNK
NT seq 4542 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacgtcgacgtcggcttccacgacggcgggttcctccggcgcggcaggcgga
ggagcagccacgcccatctccacgccctcgacgccccagccgtctggcgtgagcagcgga
cccagcaataatgtgaacaacaataacaacaacctggtctcaccctccgggaacaacaat
ttgatgacccccgtccaggcattcactccgaccggacagccagtgtacaatccacccgtc
tacatgtccgctcacggtggacacccccacgccggagcccactacccggcaatgatcccc
gctccgatgcccagcaaccacgtatacgtgaacaacgtcactgccaatgtgaacctgcat
ggctggccgcacggggttccggcttatatgccgcctggaggtcagcatcactacattgga
cacggcgacatgccccaggagcagggcaacacggtgatgccgcacctgcagcctgtgccc
atcagtttggcgccccagggcggctctccgaatccccatgttcctagaatgggtggtgga
cgcacgcgagaacgcggtcgtccccgtggaggcggaccgcgacgcaatgactaccatggg
ccacgtcatctccagcagcagcagcagcaactgatcacccttccgccgcagcagcaaatg
ccaccgccggacggagccaatcccgggctgcaacttcagccggatcagatgggtcagcag
ttggcgccgccggaggcgcatatgcagcatctacagcagtactacgccgctgcgccgcct
acctacgcctacgggccgtatccctctccctacttcacaccgcagcacgccaatctgcag
cctccccccaatgccactgctgcccagcaggccaccggtacgccgctcttcatctcggga
ccggttatgtataatcctgcgtggttcaatcacggtgggtacatctaccccatgatgcat
ccggccgagtaccagtatgtgcccgaagacgctggccagccgggagtggatgaacgtggc
gctcagccggacggcggaatgaccccgatctggcaccagggccccatgtacgcagaggac
ttcgaagtgcttcagcagcagcagcaacaggtggctgtacatcccaatggaggtgccgtc
agtgtggccgatgagctcaaccacaacagctcatccctgccctcctcggagacgtcgagc
atgctcagtccgaactaccccatctacgatccgcagatgcacgagatgcagcaccaaatg
ggcgtgatgcagatctacgacgatggtcagatggccgctctgcagcccatccatccaggc
gcgggtccgctgccacagtacgaagatgagctcgccgagtgcggagctccgccaccaggc
gctattcctgtggcctggactgctgccatgcccctgccaccggatggagtccagcctgca
ctgctgccgccgccgcatcacattttgcagcaaacatcgcccatgctaatcgaacaacca
gcccagttggttcaggcccaacctccgcagccaccaacacccacaccgcaacagcaacag
cagcaacagccacatcaggagcaagcggttgacaagagtttgacaaagaacaacaacgag
gtggtggccttggatgaaaagttggccaacgagaagcagcagcaaatcgagttagagttc
cgccagcagcaacaggagcaactgcagcagcagcaacagcaacagcatcatcatcagcaa
ccacaacagcagcaggcagaagagcagcagcagcaaaccgaaaaaccgccaacaaaagtg
ccaaacctggtggtagcaacagtggcaccgcagctgcaacagccaccaccgcagcagcag
catcagtcagcttcgcagcaacatcagcagcagcaaacatcaccggtggtggtgccgcca
cagcaacagcagcagcagcaacaacctgcgcagcagactagctaccatgatcagcatcat
ttgccgcagcagcagcaaacgcagcaaccgcagcaacagcgcaagccttcgcagcaatac
aatcaatcgcagcagcaacaggtgcgtcgcaagtactcctcagagtacaaccaccatcat
catcagcacggcagcagcgacacaggcatccaaaccaccaagaccatgtcctggaccaac
tccgcccagcacaaaaagtccacacagtcggtttcggtcaccgcttctcccaacaatgta
aacaatggaccggcagtgggtgctgcaagtggtccggcgggcaaaaccaactacagccac
accacaaagacgttcaccaaccagcagcattaccagcagcaacactaccacacccagaac
acatacaacaacaacagcaacagcggcggaagcagcagcaacagcagcgcgagcagcagc
aacaaccagcctcaggtgcgcaactatggcaccatgaaggtgccctcctcgccggtggca
agcacagcgccaacgctggagcgcaagaacagccaacagacagcggcgacacccgcagca
gcagcagctgcagcacccgtggcaatcgcaacagcaactacctcaacggccagcatcacg
gctaacccgaatcaatttcaaccggagtctggcaacagtggtgcctcgccagctgtagct
gccccgcagcaacagcagcctgcggcacagcagcatgcagcacaagcagcagcagcccca
agcaaatcgtacagcagctatgcctccaaaaagcatcagagctacgagcccgtggtcctg
agctccgtggtggccaccagctcgtcagccagctcgtcgcagccgcagctgaatcttgcc
ccacctgcgccgccagcctcgcagagcagcagcgacagttcgcagctgtcgtgggccagt
ctgtttgccagcaacaagcccgtggccaaggtggcaccatacgaggccagcaaaattgcc
cagcagcagcagcagccatcccatcccgtgctccaattggctcctccgcagccagctcaa
gtggcagctgccgctccagttgctcagctggcgtcgcctcctcaaaatgtgcctctgccc
acggctcaccagcaatcacagttgccagcacctgtgcccgcgcccacggctccgctggtc
acaccaggaacactctcctattcggctgcatccgctcaggccgttcctgctcccagcccc
gcctcggcatccgtcaaaccactgaaggcggaacccccgcgtccggtgcagcagcaactg
gatgagtggaccaacaagtacgccgagtacctgacgcgccacaagaccaatttggcggcg
atcagcctgcgtccgcgaggactgaccaacaggtcgaactactgctacataaactcgatt
ctgcaggctctgctcggctgctcgccgttctacaacctgctgcgctccattcccaagcag
gcggctgtcctgagcgaggtcaaaacgcccactgtgaacgccatgatgtcttttatgacc
aacttttcatcgctgcccagcggtctccgcctgcgtctgaacaacctcaacaagggagcc
caaagcaagggcaaggacgagtttgtgggctccgatttgcagtgcgacatggccttcgaa
cccactgagatctacaagctgtggaacgacagccgcgaggagcacgtggagggtcgtcag
gaggacgccgaagaattcttgggctatgttcttaacaagctgaacgacgagatgctggag
gtgattaagctgattgataagcccacaccccagcaaaatggtcaggaacccgcggaacca
gaggatggcggcgatgtttggcagatgatttgcaacaatcgtaacaaaggcagtgtgacc
cgccagaccgactttggacgcactcccgtaagcgatattttccggggagaactgcgctcc
cggctgcagcgtgaaggagaacactccacggatgtgattcagcctttctttacgcttcaa
ctgaacatcgaaaaagctgcatctgtaaaggaggcactagagattctagtgggtcgcgat
cagctggagggagtcacaggcagcaaaaccaaacaggaggtggtggcctggcagcagatg
acgctggagaagctgcccgtcgtcctgatattgcatttaaagtacttcgactatcgctct
gatgggtgcacaaagattttgaagaaggtggagttccccgtggaactaaagatcgatgcc
aaaatcctcggctcaaagaagacctcgcagaagcagcgcgcctatcgtctgtttgcggtc
gtctaccacgacggcaaggaggcttcgaagggccactacatcacggacgtgttccacacg
ggctacagcagctggctgcgctacgacgacagctcggtgaagccggtcagcgagaagcac
gttctccagccgcacacgcctcgtgtgccctacctgctgtactaccgccgctcagacacc
ttgccaccgcagcagcagcaaagccagcagcagaatggcggaggatcgggtggggttgtg
ggcagcagctcctcgtcatcgaatgccggggataacaagtga

DBGET integrated database retrieval system