KEGG   Drosophila yakuba: Dyak_GE21236Help
Entry
Dyak_GE21236      CDS       T01068                                 

Definition
GE21236 gene product from transcript GE21236-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 324 aa AA seqDB search
MGDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLTNFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQNKDEDVYHFVGYMPIGGRLYELDGLR
EGPIDLGEIKPEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNP
APDAMDTEEDRQTEISSLRTYIQYEIQKKKRYKVENVRRKHNYLPFIVELLKMLGETGQL
MPIYEKAKQRALDREQAQRKKDTN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacggtgctggaaattggtgtctcattgaatccgaccccggggtattcacagag
cttattcgcgaattcggatgcgatggcgcacaggtggaggagatctggagtctggacagc
gagtcgtttaagaacctggagcccatccatggtctgatcttcctgttcaagtgggtgcaa
gaggatgagcccgcaggcaaagtggtcctggaccgggagaacatcttcttcgccaagcaa
gtgatcaacaacgcatgcgccacccaggcgatcctgagcctgctgatgaacctggagcat
gaggacatcaagctgggcgagaccctcaccaatttcaaggagttctgccagtgctttgat
ccctataacaagggattaaccttaagcaacgctagccagatccgcacggtgcacaactcc
tttgcccgccagacactgttcgagctggacatgaagaaccaaaacaaggacgaggatgtg
taccactttgtgggctatatgcccatcggaggcagactgtacgagctggatggcctgagg
gagggacccattgatctgggtgagatcaagccggagcagaactggatcgatgtggtgcgt
ccgattattgagaagcgcatgcagcgctacagcgacggtgagatccacttcaacctgatg
gctctgatctcggacaggcagcgcatttacgaacagcagattgagaagttgcttaatccg
gcgcccgatgcaatggacactgaggaggatcgacagacggagatcagtagtttgcgcacg
tacattcagtatgagatccagaagaagaaacgctacaaggtggagaatgtgcggcgcaag
cacaactatttgcccttcatcgtggagctgctgaaaatgctgggcgaaactggacaactg
atgcccatctacgagaaggccaagcagagggcgctggatcgcgaacaggcgcagcgcaaa
aaggataccaactag

DBGET integrated database retrieval system