KEGG   Drosophila yakuba: Dyak_GE21247Help
Entry
Dyak_GE21247      CDS       T01068                                 

Definition
GE21247 gene product from transcript GE21247-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dya  Drosophila yakuba
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dya03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dya04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 269 aa AA seqDB search
MVVLETEKMQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAKAEAKDAKPKED
PQEAGEPAGNTATTNAPAGDDAVRTEHLFKHPLMNVWTLWYLENDRSKSWEDMQNEITSF
DTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKSDLD
NLWLDVLLCLIGEAFDHSDQICGAVVNIRGKSNKISIWTANGNNEEAALEIGHKLRDALR
LGRNNSLQYQLHKDTMVKQGSNVKSIYTL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgttggagacggagaagatgcagagcgactttcacagaatgaagaactttgct
aatcccaagtccatgttcaaaaccagcgcccccagcaccgagcagggtcgtccggaacca
cccacttcggctgcagcgcccgccaaggccgaggctaaggatgccaagcccaaggaggat
ccacaggaggctggcgaaccagcaggaaacactgcaaccaccaacgctcccgccggcgac
gatgctgtgcgcaccgagcacctgttcaaacacccgctcatgaacgtctggacgctgtgg
taccttgaaaacgatcggtccaagtcctgggaggacatgcagaacgagatcaccagcttc
gataccgtcgaggacttctggagcctgtacaaccacatcaagcccccatcagagatcaag
ctgggcagtgactactcgctcttcaagaagaacattcgtcccatgtgggaagatgcagcc
aacaaacagggcggtcgttgggtcattacccttaacaaaagctccaagagcgatttggat
aacctatggctcgatgtgctgctttgcctgattggcgaggccttcgatcactccgatcag
atctgcggggctgttgtaaacattcgcggcaagagcaacaagatatccatctggactgcc
aacggaaacaacgaggaggctgcccttgagattggtcacaagctgcgcgatgccctgcgt
ctgggacgcaataactcgctgcagtatcagttgcacaaggacacgatggtcaagcagggc
tccaacgtgaaatcgatctacactttgtag

DBGET integrated database retrieval system