KEGG   Drosophila yakuba: Dyak_GE21254Help
Entry
Dyak_GE21254      CDS       T01068                                 

Definition
GE21254 gene product from transcript GE21254-RA
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dya  Drosophila yakuba
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE21254
   00052 Galactose metabolism
    Dyak_GE21254
   00500 Starch and sucrose metabolism
    Dyak_GE21254
   00520 Amino sugar and nucleotide sugar metabolism
    Dyak_GE21254
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dyak_GE21254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 520 aa AA seqDB search
MPSGIRPIDVLLERAGVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPA
LKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPQNEQNEIRNMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLN
MEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccctccggtataagacccatcgatgttctgctggaacgtgccggtgtgcgcggccac
cagcgagcaccctccgactcaaaggagttccatgaggtgaccaaacgggatgccctgcgt
ctgctggagcacgatgtggaccgcctgctggagaccaccgagaaggcccgccagcctgcc
ctcaaggcagaaatgggtcgattcgccgatctgttcggacgtttcattcaggaagagggt
cccgcattggactggaacaagattcagaagctgcctgagaatgctgtgatgaactactcg
aatctaaagtcgccccagaacgagcagaatgagatccgcaacatgttggataaattggtg
gtcatcaagctgaacggtggtttgggcacctccatgggttgccatggtcccaagagtgtg
attcccgtgcgttcggaccttactttccttgatctgaccgtgcagcaaatcgagcacctc
aacaagacctacgatgctaatgtgccgctggtactgatgaactcctttaacaccgacgag
gacaccgagaagatcgtgcgcaagtacaagggattccgtgtgcagatccacaccttcaac
cagagctgcttcccgcgcatcagtcgtgagcactacctgccggtggccaaagacttcgat
gtcgaaaaggatatggaggcctggtacccacctggacacggtgacttctacgataccttc
cgcaactctggtctgctgaagaagttcatcgaggagggccgcgagtactgcttcttgtcc
aacatcgataacctgggcgccaccgtcgatctgaacattctcaacaagctggtgggcgag
gagcgagccaccactcctgtggagtttgtcatggaggtcactgacaagacccgtgctgac
gttaagggtggtactctcattcaaatggaaaacaagctgcgcctgctggaaattgcacaa
gttcccccagagcacgtggatgactttaagtcggttaagaccttcaagttctttaacacc
aacaacatttgggccaacctggcagcaatcgatcgtgttttgcgtgagcgtaccttaaac
atggaaattattgtaaacaacaagacgctggagaacggaacccgtgtcattcagctggag
actgctgtgggtgcggccatgaagtgctttgatggcgccatcggcatcaatgtgccacgc
tcccgtttcttgcccgtgaagaagtcctcagatctgctgcttgtcatgtcaaatttgtat
acccttaaaaacggcagcctggtaatgtcgccacagcgaatgtttcctaccacgccactc
gtcaagctgggtgagaaccacttttcaaaggtgaaggagttcctgggtcgcttcgccaac
atcccggatatcattgagctggatcacttgaccgtgagcggagatgtgactttcggtcgt
ggcgtttcattgcgcggcactgtgatcatcattgccaaccatggcgatcgtatcgatatc
cctgctggagccattctggagaacaagatcgtgtctggcaatatgcgcatcttggaccac
taa

DBGET integrated database retrieval system