KEGG   Drosophila yakuba: Dyak_GE21254Help
Entry
Dyak_GE21254      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dya  Drosophila yakuba
Pathway
dya00040  Pentose and glucuronate interconversions
dya00052  Galactose metabolism
dya00500  Starch and sucrose metabolism
dya00520  Amino sugar and nucleotide sugar metabolism
dya01100  Metabolic pathways
Module
dya_M00361  Nucleotide sugar biosynthesis, eukaryotes
dya_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE21254
   00052 Galactose metabolism
    Dyak_GE21254
   00500 Starch and sucrose metabolism
    Dyak_GE21254
   00520 Amino sugar and nucleotide sugar metabolism
    Dyak_GE21254
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dyak_GE21254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 6532593
NCBI-ProteinID: XP_002093337
FlyBase: FBpp0266264 FBgn0238524
UniProt: B4PEZ4
Position
3L
AA seq 520 aa AA seqDB search
MPSGIRPIDVLLERAGVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPA
LKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPQNEQNEIRNMLDKLV
VIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDE
DTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTF
RNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRAD
VKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLN
MEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLY
TLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGR
GVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgccctccggtataagacccatcgatgttctgctggaacgtgccggtgtgcgcggccac
cagcgagcaccctccgactcaaaggagttccatgaggtgaccaaacgggatgccctgcgt
ctgctggagcacgatgtggaccgcctgctggagaccaccgagaaggcccgccagcctgcc
ctcaaggcagaaatgggtcgattcgccgatctgttcggacgtttcattcaggaagagggt
cccgcattggactggaacaagattcagaagctgcctgagaatgctgtgatgaactactcg
aatctaaagtcgccccagaacgagcagaatgagatccgcaacatgttggataaattggtg
gtcatcaagctgaacggtggtttgggcacctccatgggttgccatggtcccaagagtgtg
attcccgtgcgttcggaccttactttccttgatctgaccgtgcagcaaatcgagcacctc
aacaagacctacgatgctaatgtgccgctggtactgatgaactcctttaacaccgacgag
gacaccgagaagatcgtgcgcaagtacaagggattccgtgtgcagatccacaccttcaac
cagagctgcttcccgcgcatcagtcgtgagcactacctgccggtggccaaagacttcgat
gtcgaaaaggatatggaggcctggtacccacctggacacggtgacttctacgataccttc
cgcaactctggtctgctgaagaagttcatcgaggagggccgcgagtactgcttcttgtcc
aacatcgataacctgggcgccaccgtcgatctgaacattctcaacaagctggtgggcgag
gagcgagccaccactcctgtggagtttgtcatggaggtcactgacaagacccgtgctgac
gttaagggtggtactctcattcaaatggaaaacaagctgcgcctgctggaaattgcacaa
gttcccccagagcacgtggatgactttaagtcggttaagaccttcaagttctttaacacc
aacaacatttgggccaacctggcagcaatcgatcgtgttttgcgtgagcgtaccttaaac
atggaaattattgtaaacaacaagacgctggagaacggaacccgtgtcattcagctggag
actgctgtgggtgcggccatgaagtgctttgatggcgccatcggcatcaatgtgccacgc
tcccgtttcttgcccgtgaagaagtcctcagatctgctgcttgtcatgtcaaatttgtat
acccttaaaaacggcagcctggtaatgtcgccacagcgaatgtttcctaccacgccactc
gtcaagctgggtgagaaccacttttcaaaggtgaaggagttcctgggtcgcttcgccaac
atcccggatatcattgagctggatcacttgaccgtgagcggagatgtgactttcggtcgt
ggcgtttcattgcgcggcactgtgatcatcattgccaaccatggcgatcgtatcgatatc
cctgctggagccattctggagaacaagatcgtgtctggcaatatgcgcatcttggaccac
taa

DBGET integrated database retrieval system