KEGG   Drosophila yakuba: Dyak_GE21358Help
Entry
Dyak_GE21358      CDS       T01068                                 

Definition
GE21358 gene product from transcript GE21358-RA
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dya  Drosophila yakuba
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dya00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dya00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 265 aa AA seqDB search
MAGRSIAHFFLGSVAIALGSYIYFTMQMSLRQFQNISRQALRCYSMRRTMGHVLELSRGQ
RQCLRLCTVLLPVSCAATPSAAASSAARHSTAAAIDMSANGDYKNAASIYEFTVKDTHGN
DISLEKYKGKVVLVVNIASKCGLTKNNYQKLTDLKEKYGERGLVILNFPCNQFGSQMPEA
DGEAMVCHLRDSKADIGEVFAKVDVNGDDAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNK
EGIPINRYAPTTDPMDIAKDIEKLL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcgttccatcgcgcacttttttctgggatccgtggctatcgccctgggatcg
tacatctacttcaccatgcaaatgagtctcaggcagtttcagaacatttcccgccaggcc
ctcaggtgctactcgatgaggcggaccatgggccacgtcctcgagctgagccggggtcag
aggcagtgcctccgcctctgcaccgttctgcttcccgtgagctgtgcggccacgccctcc
gccgccgcctcctcagccgcccggcactccacagcagctgccatcgacatgtctgctaac
ggagattacaagaacgccgcctcgatctacgagttcaccgtgaaggacacccatggcaac
gatatttcgctggaaaagtacaagggcaaggtcgtcctggtggtgaacatcgcctccaag
tgcggcctgaccaagaacaactaccagaagctgacggatctgaaggagaagtacggcgag
cgcggcctggtgatcctcaacttcccgtgcaatcagttcggttcccagatgccggaggcc
gatggcgaggccatggtgtgccatctgcgcgactccaaggccgacatcggcgaggtgttc
gccaaggtggatgtgaatggagacgatgctgcgccgctgtacaagtacctgaaggccaag
cagaccggcactttgggcagcggaatcaagtggaacttcaccaagttcctggtgaacaag
gagggcattcccatcaaccgatatgcgcccaccaccgatcccatggacatcgccaaggac
attgagaagctgctgtag

DBGET integrated database retrieval system