KEGG   Drosophila yakuba: Dyak_GE21358Help
Entry
Dyak_GE21358      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform C
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dya  Drosophila yakuba
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dyak_GE21358
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dyak_GE21358
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dyak_GE21358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 238 aa AA seqDB search
MSLRQFQNISRQALRCYSMRRTMGHVLELSRGQRQCLRLCTVLLPVSCAATPSAAASSAA
RHSTAAAIDMSANGDYKNAASIYEFTVKDTHGNDISLEKYKGKVVLVVNIASKCGLTKNN
YQKLTDLKEKYGERGLVILNFPCNQFGSQMPEADGEAMVCHLRDSKADIGEVFAKVDVNG
DDAAPLYKYLKAKQTGTLGSGIKWNFTKFLVNKEGIPINRYAPTTDPMDIAKDIEKLL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcaggcagtttcagaacatttcccgccaggccctcaggtgctactcgatgagg
cggaccatgggccacgtcctcgagctgagccggggtcagaggcagtgcctccgcctctgc
accgttctgcttcccgtgagctgtgcggccacgccctccgccgccgcctcctcagccgcc
cggcactccacagcagctgccatcgacatgtctgctaacggagattacaagaacgccgcc
tcgatctacgagttcaccgtgaaggacacccatggcaacgatatttcgctggaaaagtac
aagggcaaggtcgtcctggtggtgaacatcgcctccaagtgcggcctgaccaagaacaac
taccagaagctgacggatctgaaggagaagtacggcgagcgcggcctggtgatcctcaac
ttcccgtgcaatcagttcggttcccagatgccggaggccgatggcgaggccatggtgtgc
catctgcgcgactccaaggccgacatcggcgaggtgttcgccaaggtggatgtgaatgga
gacgatgctgcgccgctgtacaagtacctgaaggccaagcagaccggcactttgggcagc
ggaatcaagtggaacttcaccaagttcctggtgaacaaggagggcattcccatcaaccga
tatgcgcccaccaccgatcccatggacatcgccaaggacattgagaagctgctgtag

DBGET integrated database retrieval system