KEGG   Drosophila yakuba: Dyak_GE21462Help
Entry
Dyak_GE21462      CDS       T01068                                 

Definition
GE21462 gene product from transcript GE21462-RA
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dya  Drosophila yakuba
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dyak_GE21462
Enzymes [BR:dya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dyak_GE21462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 521 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVDIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRTYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASN
TNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcacagcaaaaagcgcgtttgttactactacgacagtgacattggcaactac
tactatggccagggtcatcccatgaagccgcaccgcatacgcatgacccacaacctgctg
ctcaactatgggctgtatcgtaaaatggaaatataccgtccccataaagccactgccgat
gagatgaccaagttccactcggacgagtacgtccggttcctgcgttccattcggccggac
aacatgtccgagtacaacaagcagatgcagcgtttcaatgtgggcgaggattgtcccgtc
tttgatggactctacgagttttgccaactctccgccggcggatccgtagccgcggccgta
aaactgaataagcaagcctcggagatctgcatcaattggggcggtggactgcatcatgcc
aagaaatcggaggcatccggcttctgctacgtcaacgatattgtgctgggtattttggag
ctgctgaaataccaccagcgtgttctgtacatagatatagacgttcatcacggcgatggt
gtggaggaggcgttctataccaccgatcgtgtgatgacggtgagcttccacaagtacgga
gagtatttcccgggcaccggcgatctgcgagacattggcgccggcaagggcaagtactat
gcggtgaatatacccctgcgtgatggcatggacgatgatgcgtacgagagcatctttgtg
cccattatcagcaaggtgatggagacattccagccggcagccgtggtgctgcagtgtggc
gccgactcgctgactggcgatcggttaggttgcttcaatctcaccgtcaagggacacggc
aagtgcgtggagtttgtgaagaagtataacctgcccttcctgatggtcggcggtggtggt
tataccattcgtaacgtatcccgttgctggacctatgagacctccgtggccctggccgtg
gatatagccaacgaactgccctacaacgattacttcgagtactttggtcccgatttcaag
ctgcacattagccccagcaacatgacgaatcagaatacctcggagtacctggagaagatc
aagaatcgtctgttcgagaacctgcgcatgctgccacacgctccgggcgttcaaatccag
gcgatacccgaggacgccatcaatgatgagtccgacgacgaggacaaggtcgacaaggac
gatcgcctgccgcagagcgacaaggacaagcgcattgtgcccgagaatgagtactccgat
tcggaggatgagggcgagggcggtcgcagggataaccgcacgtacaagggtcagcggaag
cgaccgcgtctggacaaggacaccaacagcaacaaggcatcctcagagacgtccagcgag
atcaaggacgaaaaggaaaagggcgatggcgctgatggcgaggagtcgacggcgtccaat
acgaatagcaacaacaacagtaacaacaagagcgataacgacgccggagcgacagctaat
gccggatccggatcgggttcaggttccggtgccggggccaagggcgccaaggagaacaac
atttga

DBGET integrated database retrieval system