KEGG   Drosophila yakuba: Dyak_GE21651Help
Entry
Dyak_GE21651      CDS       T01068                                 

Definition
GE21651 gene product from transcript GE21651-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE21651
   04068 FoxO signaling pathway
    Dyak_GE21651
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dyak_GE21651
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dyak_GE21651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 430 aa AA seqDB search
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDP
RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVI
TELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL
KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATH
EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP
SAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPS
ELPPSPHQWE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcgatgtcactggtacagggtggtgctgccggtggtgcgccacagggcgcc
agcgcaatcttggccgcagcggctccctactatcaaccgccggctgttccccaggatgtc
cagccggatcgtcccatcggctacggagcattcggagttgtctgggccgtcacagatccg
cgggatggacgacgagtggccttgaagaagctgccaaatgtgttccaatcgttggtctca
tcgaagcgcgttttccgcgagctgaaaatgctgtgcttcttcaagcatgagaatgttctt
tcagctctggacattctacagccaccgcatttggatttctttcaagaaatctatgtgata
acggagctgctgcaatcggatctgcacaagataatcgtgtcgccgcagcacctgtccgcc
gaccacatcaaggtgttcctctaccagatcctgcgcggcctcaagtatctgcactcggct
cgcatcctgcatcgcgacatcaagccgggcaatctgctcgtaaactcgaattgtgtgctc
aagatctgtgactttggattggcccgcgtcgaggagccggatcaggccaagcacatgacc
caggaggtggtcacccagtactatcgcgcaccggaaattctgatgggcgcacgccactac
tcgtcggcggtggatgtgtggtcggtgggctgcattttcggcgaactcttggggcgtcgc
atcctctttcaggcacagaatcccgtgcagcagctggagctgattacggagctgctgggc
acaccaaccatggaggatatgcgtcacgcctgcgagggtgcacgcactcacatgttgcgc
cgggcgcccaagccgccctccttctcggtgctctacacactcagctcacatgccacgcac
gaggcggtgcacctgctctgccagatgctcgtcttcgatccggacaagcgtatctcggtg
acagatgccctggcgcatccgtatctggatgagggacgtctgcggtaccactcgtgcatg
tgcaagtgctgcttcactacctcagccggaatgcgtcagtatacggctgatttcgagccc
tccgccggccagcccttcgacgatctgtgggaacgcaaactcacatccgtgcagcaggtc
aaagaggagatgcacaagttcattgccgagcagctgcaaacgggtcgtgtgccgctgtgc
atcaatccacagagtgcagccttcaagagtttcgccagttcaactgtggcacatccttcg
gagctaccgccctcgcctcatcaatgggaatga

DBGET integrated database retrieval system