KEGG   Drosophila yakuba: Dyak_GE21651Help
Entry
Dyak_GE21651      CDS       T01068                                 

Definition
GE21651 gene product from transcript GE21651-RA
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dya04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dya04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 430 aa AA seqDB search
MSVSMSLVQGGAAGGAPQGASAILAAAAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDP
RDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVI
TELLQSDLHKIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVL
KICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRR
ILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSVLYTLSSHATH
EAVHLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEP
SAGQPFDDLWERKLTSVQQVKEEMHKFIAEQLQTGRVPLCINPQSAAFKSFASSTVAHPS
ELPPSPHQWE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcgatgtcactggtacagggtggtgctgccggtggtgcgccacagggcgcc
agcgcaatcttggccgcagcggctccctactatcaaccgccggctgttccccaggatgtc
cagccggatcgtcccatcggctacggagcattcggagttgtctgggccgtcacagatccg
cgggatggacgacgagtggccttgaagaagctgccaaatgtgttccaatcgttggtctca
tcgaagcgcgttttccgcgagctgaaaatgctgtgcttcttcaagcatgagaatgttctt
tcagctctggacattctacagccaccgcatttggatttctttcaagaaatctatgtgata
acggagctgctgcaatcggatctgcacaagataatcgtgtcgccgcagcacctgtccgcc
gaccacatcaaggtgttcctctaccagatcctgcgcggcctcaagtatctgcactcggct
cgcatcctgcatcgcgacatcaagccgggcaatctgctcgtaaactcgaattgtgtgctc
aagatctgtgactttggattggcccgcgtcgaggagccggatcaggccaagcacatgacc
caggaggtggtcacccagtactatcgcgcaccggaaattctgatgggcgcacgccactac
tcgtcggcggtggatgtgtggtcggtgggctgcattttcggcgaactcttggggcgtcgc
atcctctttcaggcacagaatcccgtgcagcagctggagctgattacggagctgctgggc
acaccaaccatggaggatatgcgtcacgcctgcgagggtgcacgcactcacatgttgcgc
cgggcgcccaagccgccctccttctcggtgctctacacactcagctcacatgccacgcac
gaggcggtgcacctgctctgccagatgctcgtcttcgatccggacaagcgtatctcggtg
acagatgccctggcgcatccgtatctggatgagggacgtctgcggtaccactcgtgcatg
tgcaagtgctgcttcactacctcagccggaatgcgtcagtatacggctgatttcgagccc
tccgccggccagcccttcgacgatctgtgggaacgcaaactcacatccgtgcagcaggtc
aaagaggagatgcacaagttcattgccgagcagctgcaaacgggtcgtgtgccgctgtgc
atcaatccacagagtgcagccttcaagagtttcgccagttcaactgtggcacatccttcg
gagctaccgccctcgcctcatcaatgggaatga

DBGET integrated database retrieval system