KEGG   Drosophila yakuba: Dyak_GE21667Help
Entry
Dyak_GE21667      CDS       T01068                                 

Definition
GE21667 gene product from transcript GE21667-RA
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 828 aa AA seqDB search
MEELRKHLSKVNVPCASGAGSPPIYKDECVYSYDNPETPTGLYVCLHSFLGFGEAYVREY
ADKTGNRVFLHIQRVKTPKEGADTEAECDPESEAGPERKITRLAIGVEGGYNESDMAKKY
EIKDTYSIVVAPQLDKKLPYPDPELPMRVTQAVEAILAADSAIAKLEKATLMGTWDGEVR
QASKYAENLQQLDNGKKIPPSGWQCEKCDLTNNLWLNLTDGSIMCGRKFFDGSGGNDHAV
EHYRVTGFPLAVKLGTITADGKSDVFSYPEDDMVLDPHLERHLSHFGINMAAMKKSEKSM
VELELDINQRIGEWSALTESESELQPLAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQQR
FVGTGAERYFSEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHSTGISPAMFKN
IVGKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQTNPADALKFLLEDRVECLASRKVKY
KTREEYSFRLPVPLDKATNLDEVREFQEREKAARETGQRLLDRDIVRHKVPLQACLERFF
GPELIEQFYSTAIDGKTNARKITRLATMPDCLMIHVGKFTLGDDWVPKKLDVSVDMPDEL
DLSNWRSTGGLQPGEEALPEPAAEEVKFTFDEAVMSELLTMGFPPEACKRACFHTKNSGL
EAASNWLMEHIADEDISEPFVVPNNSIGDSAANQFVANPESLAMLMSMGFDERQAVAALK
ATDGNVERATDWIFSHADSIGVEEVAPASNSSAAAASSAPNKTDYRDGGGKYRLVAFISH
MGTSAQVGHYVCHIRKKGEWVIFNDSKVAKSQNPPKDLGYLYLYMREQ
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggaggaactacgcaagcatttatctaaggtgaacgtgccctgcgcatccggggcgggc
agtcctccgatctacaaggacgagtgcgtctactcctacgacaatcccgagacgcccacc
ggcttatacgtgtgcctgcacagctttttgggttttggcgaggcgtacgtgcgggagtac
gccgacaagaccggcaaccgggtcttccttcacatccagcgggtgaagacgcccaaggag
ggcgccgatacagaggctgaatgcgatccagagtcggaggctgggccggaacggaagatc
acccgcctggccatcggtgtcgagggtggctataacgagtcggacatggccaagaagtac
gagatcaaggacacgtacagcatcgtggtggccccccagctggacaagaagctgccctat
ccggatccggagctgcccatgcgtgtcacccaggcggtggaggcgatcctggccgctgac
tcggcaattgccaagctggagaaggccacgctgatgggcacctgggatggtgaagtgcgt
caggcctcgaagtacgcagagaacctgcagcagctggacaatggcaagaagattccgcca
tccggctggcagtgcgagaagtgtgatttgaccaacaacctctggcttaatctgaccgat
ggctcgatcatgtgcggtcgcaagttctttgacggcagtggaggcaacgatcacgccgtg
gagcactacagagtgacgggtttcccgctggcggtgaaactgggcaccatcaccgctgat
ggcaagtcggatgtgttctcctacccggaggacgacatggtacttgatccccacctagag
cgccatctctcccactttggcatcaacatggcggcgatgaagaagagcgagaagtcgatg
gtggagcttgagttggatattaaccagcggatcggcgagtggtcggcacttacagagagc
gaaagtgagctgcagcctctggctggtcctggatacactggcatgcgcaatctgggcaac
tcctgctacatcaacagcgtgatgcaggtgctcttcgtcatcccagacttccagcagcgg
ttcgtgggcaccggagcggaacgctatttcagcgagttccccagcgacccggccaatgac
ttcaacattcaaatggccaagcttggaaccggtctgcagtcgggaaagtacagcagtatt
gccgagaacactctggacaccgatcacagcaccggaatctcgccggccatgtttaagaac
attgtgggcaagaatcacccagatttcagcaccaaacaacagcaggatgccaacgatttc
tatctgcatttgctcaccctgctggacaggaattcacggaaccaaactaatcctgcagat
gctctaaagtttctgctggaggatcgcgttgagtgtctcgctagccgcaaggtgaagtac
aagacacgcgaggaatacagtttccgtctgcctgttccgttggataaggccaccaatctg
gatgaggtgcgggagtttcaggagcgtgagaaggcggcccgcgagaccggacaacggctt
ctggatcgcgacatcgtgagacacaaggttcccctacaggcttgtctggaaaggttcttc
ggcccggagctgatcgagcaattctactccactgccattgatggcaagacgaatgccagg
aaaatcacgcgattggccaccatgcccgactgcctgatgattcacgtaggaaagttcacg
ctgggcgacgactgggtgcccaagaaactggacgtttccgtggacatgcccgatgaactg
gatctgagcaactggcgctccactggtggcttgcagcctggtgaggaggctcttcctgag
cccgccgcagaggaggtgaagtttacatttgacgaggcggtcatgtccgagctgctgacc
atgggctttccaccagaagcctgcaagcgtgcctgcttccacacgaaaaacagcggactg
gaggcagcttctaactggttgatggagcacatcgctgacgaggatatctcggagccattt
gtggtgccgaacaacagcattggagacagcgcagccaaccagtttgtggccaatcccgag
agcctggccatgctcatgagcatgggcttcgacgaacgacaggctgtggctgctctgaag
gcgaccgatggcaatgtggagcgtgccactgactggatattctcacacgccgattccatt
ggtgttgaggaagttgcccccgcatcgaattcatcagctgcagcggcttcctcggcgccc
aataagaccgactaccgcgatggaggcggcaagtaccgtctagtggcattcatctcacac
atgggcacctccgcccaggtgggacactacgtctgtcacattcgcaagaagggtgaatgg
gtgatcttcaacgacagcaaggtggccaagtctcagaacccacccaaggacctcggctat
ctgtatctctacatgcgcgagcagtag

DBGET integrated database retrieval system