KEGG   Drosophila yakuba: Dyak_GE21700Help
Entry
Dyak_GE21700      CDS       T01068                                 

Definition
GE21700 gene product from transcript GE21700-RA
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE21700
Transcription machinery [BR:dya03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     Dyak_GE21700
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 695 aa AA seqDB search
MTKVTEGEISHGVQDVGNSNLEFPILAKGFVRQDSVHDFINSDSDGDFIALSGSKSDVVT
LELNSKFMVVDPCPYLVAILDSYAAETRPLDVLASRVDLVAIYDSCDVLEAQHLALEPAY
TAVCSVAVPPARLITVKRAPKQLANGNLLLGSLYTYGSLSLISKPAEYSRWNPLEELNIA
KTLRDTLLPKVNTAKIVDFKSYQEYIDPAWITMFAWLPDDSNTTGEHVLVLGTASGSLWL
LTLSADVKTLLSHHETKTCLSRICHIQAFQDLLLVGDSNGLIHLYQIPAKGSKTPTLVKP
LWEKADRMGLQMAVITECPIKDCYYITCCKAALLLTWSMPRTGSTECLKARIYIGGMKIT
GLCSLDNSSYAAGTAGSYLHRVQIIHENNQLSLQMQSIAMGVLQDFQVMGLSTSRHKNLM
TLFLYRNKEYMSETVPQKNQLLMQVLKVGNQDPLAQLISHLESNNPMNHYTDLLAELRLH
VFAEENWQRYMDYGPLDSFQFTDSATESQLQQLQIKFHVLQFVIRLQTSHLQLTVHIQKS
QDELQLLLAMLNITHIRLRLQFIGSLSMRTPFQEQATKCMFEEAHRLMNKIKTDFSEKHV
LGSTANAFVEQVDNHIQLLHKNLGIPVIANPQEKQLHRCSVSLVEISPSLERRYCSLCDR
QILFELENLRELYESGRNLTCPVCHGSFATEMFNV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagttactgagggagaaatttcacatggcgttcaagatgtggggaactctaat
ctggaatttcccatcctagccaaaggattcgtccgccaggactcggtacacgactttata
aacagcgactccgacggcgactttatagcactgagcggctccaaatcggatgtggtcact
ttggagttgaacagcaagttcatggtcgtggatccctgtccctatttagtggccatcttg
gattcttatgctgcggagacaagaccattggacgttttggccagcagagtggatttggtg
gccatatacgacagctgcgatgtcctggaggcacagcacttggccctggagccggcctac
accgctgtgtgctccgttgccgtgccaccagccagattaataactgtcaagcgggcaccc
aagcagctggctaatggaaatctgctcctgggttccctttacacctatggatccttaagc
ctaataagcaaacccgcggaatacagtcgctggaaccctctggaagaactcaatatcgct
aaaactctgagggacactctgttgcctaaagtgaacaccgccaagatagtagactttaag
agttatcaggaatatattgatcccgcctggataactatgtttgcttggttacctgatgat
tcaaataccactggcgaacatgttttggttctgggaaccgcctccggaagtttgtggttg
ctaaccttaagcgccgatgtcaaaactcttttgagtcaccacgaaacgaaaacctgcctg
agtcgtatctgccatatacaagctttccaggatcttctgctggtgggcgatagcaacgga
ctcatccacctgtaccaaataccagcaaagggaagcaagacccccaccttagtgaagccc
ttgtgggagaaagctgatcgaatgggtctgcaaatggcagtgatcaccgaatgtcccatc
aaggactgctattatataacctgctgcaaggctgcgcttttgctgacctggagtatgcca
agaacagggagcacagaatgcctgaaagcacggatctatatcggcggaatgaagatcacc
ggtctctgcagcctggacaacagtagctatgctgcaggcaccgcaggaagctatctgcat
cgcgtacaaattatccacgagaataatcagctcagcttgcagatgcaatcgatagccatg
ggtgtgcttcaggactttcaggtgatgggactaagcaccagcaggcacaagaacttaatg
accctttttctctaccgcaacaaagaatacatgagtgaaactgtgcctcaaaagaaccag
ttgctcatgcaagtgctcaaggtggggaatcaggatccacttgctcagctcatcagtcac
ttggaatcaaataaccccatgaatcactataccgatttattagctgagctacgtctacac
gtatttgccgaggagaattggcaaaggtatatggactacggtccattagattccttccaa
tttacggattccgccactgaaagccagttgcagcagctgcaaatcaaattccatgtcctg
caattcgtgattcgcctgcaaacgagccatctccagctgaccgttcacatccaaaagtcc
caggatgagctgcagctgctccttgcgatgctgaatatcacacacataagactgaggctc
cagttcattgggtcattaagtatgaggacaccattccaggagcaggcaacaaagtgtatg
tttgaggaggcccaccgactgatgaataaaattaagaccgacttttcggaaaagcatgtc
ctaggatccacagcaaacgcattcgttgagcaagtagataatcatattcagctcctgcat
aagaatctgggtattcctgtgatagctaatccccaggagaagcaacttcatcgctgcagt
gtgtcccttgtcgagatctcccccagcttggagcgacgctactgcagcctgtgcgaccga
cagatcctcttcgagttggaaaacctgcgagaactctacgaatccgggagaaatctgaca
tgtcctgtttgccatggaagcttcgcaacggaaatgtttaatgtataa

DBGET integrated database retrieval system