KEGG   Drosophila yakuba: Dyak_GE21760Help
Entry
Dyak_GE21760      CDS       T01068                                 

Definition
GE21760 gene product from transcript GE21760-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dya  Drosophila yakuba
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dyak_GE21760
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dyak_GE21760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 236 aa AA seqDB search
MISFLFIVNRALSSSSSGVSSSAATLTRSKKKMTAPGPRPLVLCGPSGSGKSTLLKRLFA
EFPNTFGFSISHTTRKPRAGEEHGVHYYFVERPEMEEAIAGDEFIETAEFTGNLYGTSKA
AVREIQAQGRVCILDIEQKGVEQIRRTDLNPILIFNNPPSIEELERRLRQRGSETEESLS
KRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQEKQGVSVSLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgcgcgctcagcagcagcagcagcggcgtcagc
agcagtgcggcaaccttaacgagaagcaagaagaagatgaccgcccccgggccacgcccc
ctcgtcctatgcggaccctcgggctccggaaaaagtacgctgctgaagaggctatttgcg
gaattccccaacaccttcggcttcagcatatcgcacaccacgcggaagccacgcgctggc
gaggagcacggagtgcactactactttgtggaacggccggaaatggaggaggccatcgcc
ggcgacgagttcatcgagacggcggagtttacgggtaatctgtatggaacgagcaaggcg
gcggttagggaaatccaggcacagggacgcgtctgcatactggacatcgagcagaagggt
gtggagcagatacgtcgcacggatctcaatcccatactgatcttcaacaatccaccgagc
atcgaggagctggaacgacgactgcgtcaacgtggctccgaaacggaggagtcgctgagc
aagcgcctcaatgccgcccaggtggaactcgattatggtttgacgccgggcaacttccac
aagatcatcaacaatgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtc
caggaactcaaggagcaggagaagcagggagtatccgttagcctgaagtaa

DBGET integrated database retrieval system