KEGG   Drosophila yakuba: Dyak_GE21760Help
Entry
Dyak_GE21760      CDS       T01068                                 

Definition
GE21760 gene product from transcript GE21760-RA
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dya  Drosophila yakuba
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dya00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 236 aa AA seqDB search
MISFLFIVNRALSSSSSGVSSSAATLTRSKKKMTAPGPRPLVLCGPSGSGKSTLLKRLFA
EFPNTFGFSISHTTRKPRAGEEHGVHYYFVERPEMEEAIAGDEFIETAEFTGNLYGTSKA
AVREIQAQGRVCILDIEQKGVEQIRRTDLNPILIFNNPPSIEELERRLRQRGSETEESLS
KRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQEKQGVSVSLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgataagctttctgttcattgtaaatcgcgcgctcagcagcagcagcagcggcgtcagc
agcagtgcggcaaccttaacgagaagcaagaagaagatgaccgcccccgggccacgcccc
ctcgtcctatgcggaccctcgggctccggaaaaagtacgctgctgaagaggctatttgcg
gaattccccaacaccttcggcttcagcatatcgcacaccacgcggaagccacgcgctggc
gaggagcacggagtgcactactactttgtggaacggccggaaatggaggaggccatcgcc
ggcgacgagttcatcgagacggcggagtttacgggtaatctgtatggaacgagcaaggcg
gcggttagggaaatccaggcacagggacgcgtctgcatactggacatcgagcagaagggt
gtggagcagatacgtcgcacggatctcaatcccatactgatcttcaacaatccaccgagc
atcgaggagctggaacgacgactgcgtcaacgtggctccgaaacggaggagtcgctgagc
aagcgcctcaatgccgcccaggtggaactcgattatggtttgacgccgggcaacttccac
aagatcatcaacaatgtggacatcgatgtggcctacgaggagttccgcaactttgtcgtc
caggaactcaaggagcaggagaagcagggagtatccgttagcctgaagtaa

DBGET integrated database retrieval system