KEGG   Drosophila yakuba: Dyak_GE21832Help
Entry
Dyak_GE21832      CDS       T01068                                 

Definition
GE21832 gene product from transcript GE21832-RA
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dya  Drosophila yakuba
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dyak_GE21832
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dyak_GE21832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 216 aa AA seqDB search
MAAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIQSARDNVHGMIQKEISAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPGAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYNGLSHSSSDDEMDDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccggtcattgtcgaggccacggccaagcaaaccgccacgctgatcttcatg
cacggcctgggtgatacgggccatggatggagcagcgccctagccgccatccgcccacct
ttcatgaaagtcatctgccccacggcgcccacacagcccgtttcgctgaacgccggcttc
cggatgccatcgtggttcgacctgaagacactggacatcggtgggcccgaggacgagccg
ggcatccagtcggcgcgcgataatgtgcacggtatgattcagaaggagatcagtgctggt
attccggccaatcgcattgtcctgggcggattctcgcagggaggagccttggcactgtat
tcggcactcacgtacgaccagccgctggccggcgtggtggccctttcctgctggctgccg
ctgcacaagcagttcccaggcgccaaggtgaacagcgatgatgtgccgatttttcaggcg
catggcgactacgatcccgtggtgccgtacaagttcggccagctgagcgccagcctgctc
aagtcgttcatgaagaatgtgacgttcaagacatacaatggactatcgcactcgtcgtcc
gacgacgagatggatgacgtcaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system