KEGG   Drosophila yakuba: Dyak_GE22066Help
Entry
Dyak_GE22066      CDS       T01068                                 

Gene name
dyak_GLEANR_5774
Definition
(RefSeq) GE22066 gene product from transcript GE22066-RB
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE22066 (dyak_GLEANR_5774)
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE22066 (dyak_GLEANR_5774)
Transcription machinery [BR:dya03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dyak_GE22066 (dyak_GLEANR_5774)
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dyak_GE22066 (dyak_GLEANR_5774)
Chromosome [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     Dyak_GE22066 (dyak_GLEANR_5774)
    SLIK complex
     Dyak_GE22066 (dyak_GLEANR_5774)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 496 aa AA seqDB search
MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACL
HCIYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKD
LQKSIGWVPWVPTAKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTP
LLSDYFMSDRHDCGSKSSPKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGY
EQQDAHEFFIATLDVLHRHCVKAKAEHDSKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQ
IFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLG
SAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTP
FMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLD
SEGYLLFYHKNVLEYE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgggctgtcggcactaccagagctacgtaaaggagcacagctacgataca
ttccgggtcatcgacgcctacttcgctgcctgcgtcaacagagatgcgcgcgagcgaaag
gctatacactgcaactgcttcgagtgcggcagctacggcatccagttgtacgcctgcctg
cactgcatctacttcggatgtcgaggggcccacatcacgagtcacctgcgatccaagaag
cacaatgtggccctggagctgtcccacggaacgctctactgctacgcctgccgagatttc
atctacgacgcgaggagccgcgagtatgcgctgatcaaccgcaagctggaggccaaggat
ctgcagaagagcatcggctgggtgccgtgggtgcccacggccaaggagaccaatctgctg
ctggccaatgccaggcgtcgactggtgaggcccaatcagacgatcggactgaggggtctg
ctgaatctgggcgccacttgcttcatgaactgcatcgtccaggctctggttcacactccc
ctgctcagcgactacttcatgtcagatcgccacgactgcggcagcaagtcctcgcccaaa
tgtctcgtttgcgaagtttcgcgtctcttccaggagttctactctggctcccgttcgccg
ttgtcgctgcaccggctactgcatttaatctggaaccatgcgaagcacttggccggctac
gagcagcaggacgcgcacgagttcttcatcgccaccctggacgtgctgcatcggcactgc
gtaaaggccaaggcggagcacgacagcaagagcaacagctctgggtcgggaagtggaact
aattcgagcaactcgagcagctcgcattgctacggccagtgtaactgcatcatcgaccag
atcttcacgggcatgctgcagagcgatgtggtgtgccaggcctgcaacggagtgtccacc
acctacgatcccttttgggacatttccctggacctgggcgaaacaacgacgcatggcggt
gttaccccaaaaacgctgatcgactgcctggagcggtacacacgggccgagcatctcggt
tcggccgccaaaatcaagtgctctacctgcaagtcctaccaggagtccaccaaacagttc
agcttgcgcactctgcccagcgtggtgtccttccatctgaaacgcttcgagcactcggct
ctcatcgatcgcaagatctcctcgttcattcaattccccgtggagttcgacatgacgccc
ttcatgtccgagaagaagaacgcctatggggacttccggttctcgctgtacgccgtggtc
aatcacgtgggcaccatcgacaccggacactatacggcgtatgtgcgccaccagaaggac
acgtgggtcaagtgcgatgatcatgtgataacgatggcatcgctcaagcaggtgctggac
agcgagggttatttattgttctaccataaaaacgtgctggaatacgagtaa

DBGET integrated database retrieval system