KEGG   Drosophila yakuba: Dyak_GE22350Help
Entry
Dyak_GE22350      CDS       T01068                                 

Definition
GE22350 gene product from transcript GE22350-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dyak_GE22350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE22350
   00620 Pyruvate metabolism
    Dyak_GE22350
   00640 Propanoate metabolism
    Dyak_GE22350
Enzymes [BR:dya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dyak_GE22350
Lipid biosynthesis proteins [BR:dya01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dyak_GE22350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 595 aa AA seqDB search
MEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH
GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITAD
GAWRGEKALYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRD
YWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFD
YKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQF
YTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKHIGKEQCSIVDTFW
QTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGEGYLVFSQPWPGMM
RTLYNNHERFEDTYFSKFPGFYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVES
VLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDLKKMVRERIGPFAMPD
VIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLFANRPVEAK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgcctccaccaatctgtgctacaatctactggatcgcaacgtgaggaacggt
ctgggcgaccagatagcctactactgggagggcaaccaccccgacgattattcccggggt
ctcacctatcgcaagttgctggaggaggtgtgccggttcgccaatgtgctgaaggatcat
ggaattcgaaagggcgatcgtgtgtccatctacatgcccatgattctggagctgcccatc
gcgatgctggcctgcgcccgcattggagccgtgcactcgatcgtcttcgccggattttca
ccggactcactggcggagcggatgttcgattgcaaggccaagctgctgattacggcggat
ggagcttggcgtggagagaaagccctgtacctgaaggcgctgtgcgacacggccttagag
aaggtcgaggagatgggtcactccgtggagaagtgcattgtggtgtcgcacttgaagcgc
gtgactccgtgccagccggatcatgtcgaggaggaaattccgtggaccgatgaccgcgat
tactggtggcatgaggagatggaggacaaggagccggcctgctatcccgagtggatggat
gccgaggatccgctgttcatgctctacaccagtggctccactggcaagcccaagggagtg
cttcacacgaccgccggatatctgctgtatgcggccacaaccttcaagatcgtctttgac
tataagccaggggatatctactggtgcaccgccgatgttggctggatcacaggacacacc
tacgtggtgtacggaccgttggccaatggtgccacttcagtgattttcgagggcacacca
ttcttccctggaaacgatcggtactggagtgtcattgacaaatataaggtcacccagttc
tacacagctcctacggcgattcgcgctctcatgaagttcggcgagggtcccgttctgaag
cacaacctgagcggactcaaagttttgggcagcgtgggtgagcccataaacccggaggcc
tggctgtggtattacaagcacattggaaaggaacagtgctccattgtggacaccttttgg
caaacggaaacaggtggacatgtcattacacccctgcctggagcgactcccatgaagccg
ggatctgcttcattccccttctttggcgtcaagcccactttgctggatgagtgcggaatc
gaaattaagggagagggcgagggctacttggtcttctcgcagccttggccgggaatgatg
cgcaccttgtacaacaaccatgaacgcttcgaggacacttacttctccaagttcccaggt
ttctactgcactggcgatggagcccgtcgcgatgctgatggctatctgtggatcactggt
cgtgtggacgacatgttaaacgtgtccggtcatctgatgtccaccgccgaagtagagtcg
gttctcacagagcatcctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtc
aaaggcgagtgtctctactgcttcattacgcccaacgagaacgaggtctttgatcaaaag
cttatttctgaccttaagaagatggtgcgagaacgcatcggcccttttgccatgccggat
gtcattcaaaacgctcccggactgcccaaaacccgttccggcaagattatgcgccgtgtg
ctgcgcaagatcgcggtaaacgatcgcaacgtgggcgacacatctaccttggccgatgag
caaatcgtggagcaactgttcgccaaccggccagtggaggccaagtag

DBGET integrated database retrieval system