KEGG   Drosophila yakuba: Dyak_GE22600Help
Entry
Dyak_GE22600      CDS       T01068                                 

Definition
GE22600 gene product from transcript GE22600-RA
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
dya  Drosophila yakuba
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dyak_GE22600
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dyak_GE22600
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Dyak_GE22600
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dyak_GE22600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 776 aa AA seqDB search
MLRNSFYLAQSLRNGFSRIAWRAVSSHGPRQPLVSPERRLEKAHPTFTERSQLKYARRLV
VKLGSAVITREDNHGLALGRLASIVEQVAECHLEGREVMMVTSGAVAFGKQKLAQELLMS
LSMRETLNPKDSKEFDGATLEPRAAAAVGQSGLMSLYDAMFAQYGVKIAQVLVTKPDFYN
EETRNNLFCTLSELISLNIVPIINTNDAVSPPMFIRDDEPAGGARRGIPIKDNDSLSAML
AAEVQADLLILMSDVDGIYNKPPWEDGAKLMHTYTSDDSNSIEFGKKSKVGTGGMDSKVK
AATWALDRGVSVVICNGMQEKAIKTIIGGRKVGTFFTEATESANAVPVEVMAENARTGSR
QMQALTPAQRASAVNTLADLLVSREKFILDANAKDLAEAQKSGLAKPLLSRLSLNPAKLK
NLSVGLKQIAEDSHKNVGRVLRRTRLADQLELKQVTVPIGVLLVIFESRPDSLPQVAALA
MASANGLLLKGGKEAAHSNKALMELVKEALATVGAEHAVSLVSTREEISDLLSMENHIDL
IIPRGSSDLVRSIQQQSLHIPVLGHAEGVCHVYIDRDADLQKALRIARDAKCDYPAACNA
METLLIHEDLMSGAIFGDVCNMLKREGVKIYAGPRLNQQLTFGPPAAKSLKHEYGALECC
IEVVPSLDEAINHIHTYGSSHTDVIVTENDAAAKQFLGSVDSACVFHNASSRFADGFRFG
LGAEVGISTARIHARGPVGVEGLLTTKWILEGQDHAAADFAEGGGRTWLHETLPLD
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaaacagtttttacctggcccagagcctccgaaacggcttttccagaatcgcc
tggcgagcggtcagctcccacggaccccggcagccactggtgtcgccggagcggcgcttg
gaaaaggcgcatcccaccttcacggaaaggagtcagttgaagtacgcccggaggctggtg
gtaaagttgggcagtgcagttattacacgagaggacaaccatggactagccctcggacga
ctggcgtctattgtggagcaagttgccgagtgccatttggagggacgtgaggtgatgatg
gtcaccagtggagcggtggcctttggaaagcaaaagctcgcccaggagctgctcatgtcc
ctatccatgcgcgagaccctaaacccaaaggatagcaaagagttcgacggtgccacgctg
gagccgcgagcggcggctgcggtgggtcagtcaggtctgatgtccctatacgatgcgatg
tttgcccagtacggcgtcaaaatagcccaagtgctggtgaccaagccggacttctacaac
gaggagacacgcaacaatctcttctgcacgctctccgaattaattagccttaatattgtg
ccaatcataaatactaacgacgccgtctccccaccgatgtttatacgtgacgacgagcca
gccggcggagccaggaggggtattcccattaaggacaacgacagcttgtctgccatgcta
gccgccgaggtgcaggcggatctgctaatcctgatgtcggacgtcgatggtatctacaat
aagccgccgtgggaggatggggccaagctgatgcacacctacaccagcgacgacagcaac
agcatcgagtttggaaaaaagtcaaaggtgggtaccggcggcatggactccaaggtgaag
gcggccacctgggccctggaccgtggtgtcagcgtggtcatctgtaacggaatgcaggag
aaggccatcaagaccataattggcggccggaaggtgggcaccttcttcacggaggccacc
gagagcgccaatgcagtgcccgtcgaggtgatggccgagaacgcgcgaaccgggagtcgc
cagatgcaggccctcacgcccgctcagagagccagtgctgtcaacaccttggccgacctg
ctggtgagccgcgagaagtttatcctggacgccaacgccaaggacttggccgaggcccag
aagagcggactggccaagccgctgctatcgcgcctctcactcaacccggccaagctgaag
aacctttccgttggcctgaagcaaatcgccgaggacagtcacaagaatgttgggcgtgtc
ctgcgacgcacccgccttgcggatcagctggagctcaaacaggttaccgttcccataggc
gtcctgctggtcatctttgaatcccgtccagactcgctgcctcaggtggccgccttggca
atggcctcagccaacggactgttactgaagggcggcaaggaggcagcgcacagcaacaag
gctctgatggaactggtcaaggaggcgctggccaccgtgggagcggagcacgccgtgtca
ctagtttccacgcgcgaggagatcagcgatctgctgtccatggagaaccacatcgacttg
atcatcccgcgcggctcctccgacttggtgcgcagcatacagcagcagtcgctgcacatc
cccgttctgggccacgccgaaggtgtctgccacgtatatatcgatcgggatgcggatctg
caaaaggccctgcgcattgcacgtgacgccaagtgcgactatccggctgcctgcaacgcc
atggagaccctgctgatccacgaggacctgatgagtggcgcaatcttcggcgatgtctgc
aacatgctaaaacgtgagggcgtcaaaatctatgccggaccccggctgaaccagcagctg
acctttggcccgccggcggccaagagcctgaagcacgagtacggagccctcgagtgctgc
atagaggtggtgcccagtctggacgaggccattaatcatatccatacgtacggcagcagc
cacacggatgtcattgttacggaaaatgatgcggcggccaagcagtttttgggcagcgtg
gacagcgcctgtgtgttccacaacgccagctcccggttcgcggacggcttccggttcggc
cttggcgccgaggtgggcatctccaccgcccggatccacgcccgcgggccagtgggcgtg
gaggggctgctgaccaccaagtggattctcgaggggcaggaccacgccgccgccgacttt
gctgagggaggtggccgcacgtggctgcacgagaccctgccgctggattaa

DBGET integrated database retrieval system