KEGG   Drosophila yakuba: Dyak_GE22864Help
Entry
Dyak_GE22864      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dya  Drosophila yakuba
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dyak_GE22864
  Replication and repair
   03420 Nucleotide excision repair
    Dyak_GE22864
Transcription machinery [BR:dya03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dyak_GE22864
DNA repair and recombination proteins [BR:dya03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Dyak_GE22864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 254 aa AA seqDB search
CEERGISLPECLSMLFQLSFSTLGRDYSSEGMNSQMLTFLQHLREFGLVFQRKRKEGRFY
PTRLALNVTSKEAAATASVAMDEEATQDCGYIVVETNYRVYAYTDSPLQVAVLGLFTELL
YRFPNLVVGVLTRDSVRQALRGGITAEQIVSYLEQYAHPNMRLVESAIQSKSCLPPTVVD
QIKLWELERNRFTYTEGVVYNQFLSHTDFVTLRDYAQSIHMLVWQNERTRTMVVQKNGHD
DVKRYWKKYSKSGV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
tgcgaagagagagggatcagcctgccggaatgcttgtccatgttgttccaacttagtttt
tcaacgctgggcagggattacagttcggagggcatgaacagtcagatgctcaccttcctg
cagcatctacgggagtttggactggtcttccagcgtaagcgtaaggagggacgcttttat
cccacacgtttggctctgaatgtaaccagcaaggaggcggctgcgactgcctctgtggcc
atggatgaggaggctactcaggactgtggctacatcgttgtggagactaattaccgggtg
tatgcctacactgattctccgctgcaggtggccgtgttaggtctgttcacggagcttctc
taccgctttcccaatcttgtcgtgggcgtgctaactcgggattcagtgcgtcaggcgttg
cgtggcggtattacggcagagcagattgtctcgtatctggagcagtatgcgcatcccaat
atgcgactggtcgagtctgccattcagtccaaatcctgcctgcctcccacagtcgttgat
caaattaagctgtgggaactagagcgaaatcgcttcacctacaccgaaggcgtggtgtac
aatcagttcctctcgcatacagatttcgtaacgctaagagactacgctcagtcgatccac
atgctggtgtggcaaaatgagcgaactcgcacaatggtggtgcaaaagaatggccacgat
gatgtgaagcgttactggaagaagtactctaagagtggtgtttaa

DBGET integrated database retrieval system