KEGG   Drosophila yakuba: Dyak_GE22961Help
Entry
Dyak_GE22961      CDS       T01068                                 

Definition
GE22961 gene product from transcript GE22961-RA
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dya01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dya00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dya00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dya00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 609 aa AA seqDB search
MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADPEKFL
KYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRK
LLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLA
ERMFDCKAKLLITADGAWRGEKALYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQ
PDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGN
DRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYY
KHIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGE
GEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGFYCTGDGARRDADGYLWITGRVDDM
LNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISXX
XXFFVVVVV
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgaaaaatcaatatacgatcccaatccggccatcagccaaaatgcctacata
tccagcttcgaggagtatcagaagttctaccaggagtcgctggacaatccggccgagttc
tggtcccgcgtggccaagcagttccactgggagacgcccgccgacccggagaagttccta
aagtacaacttcaacatctccaagggacccatttcgatcaaatggatggagggtgcctcc
accaatctgtgctacaatctactggatcgcaacgtgaggaacggtctgggcgaccagata
gcctactactgggagggcaaccaccccgacgattattcccggggtctcacctatcgcaag
ttgctggaggaggtgtgccggttcgccaatgtgctgaaggatcatggaattcgaaagggc
gatcgtgtgtccatctacatgcccatgattctggagctgcccatcgcgatgctggcctgc
gcccgcattggagccgtgcactcgatcgtcttcgccggattttcacctgactcactggcg
gagcggatgttcgattgcaaggccaagctgctgattacagcggatggagcttggcgtgga
gagaaagccctgtacctgaaggcgctgtgcgacacggccttagagaaggtcgaggagatg
ggtcactccgtggagaagtgcattgtagtgtcgcacttgaagcgcgtgactccgtgccag
ccggatcatgtcgaggaggaaattccgtggaccgatgaccgcgattactggtggcatgag
gagatggaggacaaggagccggcctgctatcccgagtggatggatgccgaggatccgctg
ttcatgctctacaccagtggctccactggcaagcccaagggagtgcttcacacgaccgcc
ggatatctgctgtatgcggccacaaccttcaagatcgtctttgactataagccaggggat
atctactggtgcaccgccgatgttggctggattacgggacacacctacgtggtgtacgga
ccgttggccaatggtgccacttcagtgattttcgagggcacaccattcttccctggaaac
gatcggtactggagtgtcattgacaaatataaggtcacccagttctacacagctcctacg
gcgattcgcgcactcatgaagttcggcgagggtcccgttctgaagcacaacctgagcgga
ctcaaagttttgggcagcgtgggtgagcccataaacccggaggcctggctgtggtattac
aagcacattggaaaggaacagtgctccattgtggacaccttctggcaaacggaaacaggt
ggacatgtcattacacccctgcctggagcgactcccatgaagccgggatctgcttcattc
cccttctttggcgtcaagcccactttgctggatgagtgcggaatcgaaattaagggagag
ggcgagggctacttggtcttctcgcagccttggccgggaatgatgcgcaccttgtacaac
aaccatgaacgcttcgaggacacttacttctccaagttcccaggtttctactgcactggc
gatggagcccgtcgcgatgctgatggctatctgtggatcactggtcgtgtggacgacatg
ttaaacgtgtccggtcatctgatgtccaccgccgaagtagagtcggttctcacagagcat
cctcgcgtggctgagtccgccgtggtttcccgtccgcatcccgtcaaaggcgagtgtctc
tactgcttcattacgcccaacgagaacgaggtctttgatcagaagcttatttctgnnnnn
nnnnntttcttcgttgtagtcgtagtttaa

DBGET integrated database retrieval system