KEGG   Drosophila yakuba: Dyak_GE23042Help
Entry
Dyak_GE23042      CDS       T01068                                 

Definition
GE23042 gene product from transcript GE23042-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dya00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dya00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 367 aa AA seqDB search
MVRVIEDMFGIAVNPMTQKTDRVRRFTLSTERGMSVSILTMGAIIQSLKVPDFNGKLEDV
CLGYDDVAGYYRNQQCFFGATIGRVANRTAHGRFKLCGKEVSVSRNIRDRHHQHGGFVGF
DSVIWDVVGVHKDGVTLQHISPDGHEGYPGELTTNINFSLNETGCFGMRIEARTKATTVV
NISNHSYFNLGGHGAGRDPLYQHMLMIKAQKIVDVDQELLPTGKLMRVRTTPYDFSSLVS
LGKRLNQVSACPLGGFDNHFCVDIPPNRVQLVARVVHPCSGRFMEVHTNQPGLQFSTANH
LPDEDSADIPNVGKDGVRYVRQGAFTLQTQKYPDAMNHCDFPTIVLNPGQLYDHQVVYRF
GACPKRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgagtgatcgaggacatgttcggcatcgccgtcaacccgatgacgcagaagacc
gaccgggttcggcgcttcacgctgagcacagagcgtgggatgtcggtgtcgatcctaacg
atgggtgccatcatccagtccttgaaggttcccgacttcaacggcaagctggaggacgtg
tgcctgggctacgacgacgtggcagggtactaccgtaaccagcagtgcttctttggagcc
accattggccgggttgccaaccgtacagcacatggtcgcttcaagctctgcggcaaggag
gtcagtgtgagtcgcaatattcgggatagacatcaccagcacggcggattcgtgggcttc
gacagcgtcatctgggacgtggtgggggtgcacaaagacggcgtcaccttgcagcacatc
tcgccggatgggcacgagggctatccgggcgagctgaccaccaacattaacttctcgctc
aacgagacgggctgctttgggatgcgaatagaggcgcggacgaaggctaccacggtggtg
aacatctcgaaccacagctacttcaacttgggcggccacggcgccggccgggatccgctc
tatcagcacatgctgatgatcaaggcccagaagatagtggacgtggaccaggagcttctg
cccactggaaagttaatgcgcgtccgcaccacgccgtacgacttctccagcctggtcagt
ctgggcaagcggctcaatcaggtgtccgcttgccccctgggcggcttcgacaaccatttc
tgcgtggacattcctcccaaccgggtgcaactggtggcccgtgtggttcatccatgtagc
ggccgtttcatggaggtgcacaccaaccagccgggcctgcagttcagcacggccaaccat
ctgccggacgaggacagcgcggacatacccaacgtgggcaaggatggggtccgctatgtc
cgccagggagccttcaccctgcagacgcagaagtaccccgacgcaatgaaccactgcgac
ttccccacaatcgtgctcaatcctggccagctgtacgatcaccaggtggtttaccgattt
ggcgcctgtcccaagcgagtgtag

DBGET integrated database retrieval system