KEGG   Drosophila yakuba: Dyak_GE23130Help
Entry
Dyak_GE23130      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dyak_GE23130
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   Dyak_GE23130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L
AA seq 588 aa AA seqDB search
MEMWHKFLDRILVVWRVSTCVFAIFGFGLYSCWKQIWGDHDLASALREGLATPTQGGKAT
GDNGTTGTPARTIGNPQARIASEMSTATCARFCTPLSSGTAGSTSKLTTGNGSGNTMTSA
YKKKIPSNNSTTANTANDSSNTETTFTFKLGRSNGRSSSNVASSESSDPLESDYSEEDPE
QEQQRPDPVTNSRSSSTATTTTTSSADHDNDVDEEDEEDDEDEEEGNGRDADDVTHDSSE
SIEEDDGNETDDEEDDDESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVCLCRDRI
SEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMIFDYVC
GGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITD
FGFAKKLRDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPF
GIYEKILSGKIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWND
VYSKKLKPPILPDVHHDGDTKNFDDYPEKDWKPAKAVDQRDLQYFNDF
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgtggcataaatttttggatcgtattttagtggtttggagagttagcacatgt
gttttcgcgattttcggcttcggattatattcctgctggaagcaaatttggggcgaccat
gatttggcttccgctctgcgggaaggactggccacgcccactcaaggaggaaaagcgaca
ggagacaacgggacgacaggaactccggcaaggacaatcgggaatccgcaggcgaggatt
gcgagtgagatgtccacggcgacttgtgcccgcttctgcacgcctttgtcatccggcacg
gcaggatccacatcaaaattgacaaccggaaacggaagcggcaacacgatgacgtcggcg
tacaagaagaaaattccatcaaacaacagcacaacagcaaatacagcaaatgacagcagc
aacacagagacaacattcacattcaaattgggccgctcgaacggccggagcagcagcaac
gtagcctccagcgagtcatccgatcccctggagtccgattacagcgaggaggatccggag
caggagcagcagcgtcccgatccggtgaccaacagccggagcagcagcaccgccaccacc
accaccaccagttccgctgaccatgacaatgacgttgacgaggaggatgaggaggacgac
gaggacgaggaggagggcaacggccgggatgcggatgacgtcactcacgattccagcgag
agcatcgaggaggacgatggcaatgagaccgatgacgaggaggacgacgacgagtccgag
gagagcagcagtgtccagaccgcgaagggagtgcgcaaataccacttggacgactaccag
ataatcaaaacagtgggcacgggcacctttggacgagtgtgcttatgtcgcgatcgcatt
tcggagaagtactgtgccatgaagattttggccatgaccgaagtcattcgtctcaaacag
attgaacacgttaagaacgagcggaatatattgcgcgaaatacgacatccgtttgtcatc
agcctggaatggtccacaaaggatgactcaaatctgtatatgatcttcgattatgtctgc
ggcggagagctattcacatatctgcgaaatgcaggaaaattcactagtcaaacctccaac
ttctatgcggctgagatcgtcagtgccctggaatacctgcactcactgcaaattgtttat
cgtgacttaaagccagagaatctgctgatcaatagggatggccatttaaaaataacagat
ttcggctttgccaaaaagctgagggatcgcacttggactttgtgcggaacacctgagtat
atagcacctgagataatccagtccaagggtcacaataaagccgtagattggtgggcattg
ggagttctcatctacgaaatgctcgtgggttacccaccattctacgatgagcagcccttt
gggatttatgagaaaatattgagcggaaaaattgagtgggagcgtcatatggatcccatt
gccaaagacttgatcaaaaagctgttggtgaatgatagaaccaagcgactgggcaacatg
aagaatggcgccgatgacgtgaagaggcatcgctggttcaagcacttgaattggaatgac
gtctacagcaagaaacttaagccaccaattctgcccgatgtacaccacgatggggatacc
aaaaattttgatgattatcccgagaaggattggaagcccgccaaggcagtagaccaaaga
gatttgcagtacttcaatgatttctaa

DBGET integrated database retrieval system