KEGG   Drosophila yakuba: Dyak_GE23318Help
Entry
Dyak_GE23318      CDS       T01068                                 

Definition
GE23318 gene product from transcript GE23318-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE23318
   00053 Ascorbate and aldarate metabolism
    Dyak_GE23318
   00500 Starch and sucrose metabolism
    Dyak_GE23318
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE23318
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE23318
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE23318
   00982 Drug metabolism - cytochrome P450
    Dyak_GE23318
   00983 Drug metabolism - other enzymes
    Dyak_GE23318
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE23318
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE23318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 520 aa AA seqDB search
MWPILLLLCLLPGYLEGARILAVFPLPSPSHYFFALPYLKSLASLGHEITSVSPYPQKEP
FENIHDIPVPEVFENFNEVLRIASTPRSTWRSSDFINEYVLNLTRTVLNNEGVRRSILGP
QKPHFDLVVMDVWRFDVLIGLAAYFDAPIIGLGSYGTDWKIDELMGNISPMSYLQSPSSR
FYDLEAYGQRLSYLVERTLMHINYKWRHVRKQEALYRQYFPSIAERKPLSKISRNFSLVL
LNQHFTLGPPRPYVPNMIEVGGLHVNPKPEALPAELDNFIQGAGESGVIYFSLGTNVKSK
SLSEDRRKVLLETFASLPQRVLWKFEDEQLPGKPSNVFISKWFSQQSILAHRNVKLFITH
GGLLSTIESIHHGKPMLGLPCLFDQFRNMAHVQQMGLGLVLNIKEMTSEDFNSTIRRLLT
NKTFEETARITAARHRDQPMKPLDTAIWWTEYVLRHKGAAHMQVAGKDLDFVRYHSLDVF
GTFLIGALGLPVVIIFCIYVILRKCILQKKDTNEAIKKMQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtggccaatcttgctgctgctgtgtcttcttcctggttatttggaaggtgctcgcatc
ctggcagtgttccccttaccaagtccttcgcattacttcttcgccttaccctatcttaag
agtttagcctccctgggccatgaaatcaccagcgtaagtccgtatccacaaaaggagccg
tttgagaatatacacgacattccagttccggaggttttcgaaaactttaatgaagtcctc
aggattgcatccactcccaggagcacctggcgaagtagtgatttcattaacgaatacgtc
ctgaatcttacaaggacagtgctaaataacgagggagtgcgtcgcagtatcctgggccca
cagaagcctcacttcgatcttgtggtaatggatgtttggcgattcgacgttctgattggc
ctggctgcctatttcgatgcccccatcattggattgggttcctatggcaccgactggaag
atcgacgaattgatgggcaacatctcaccgatgtcgtacctgcaatctccctcctcaaga
ttttacgatctggaggcttatggacagcggttgtcataccttgtggagcgaactcttatg
catatcaactataagtggcgacatgtgcggaaacaggaagctctctataggcaatacttc
cccagcatcgctgagaggaaacccttgtcgaagatatccaggaacttttctttggtcctc
ctcaatcagcacttcacgctcggtcccccgcgtccttatgttccgaatatgattgaggtg
ggtggtctgcatgtgaatccgaagccagaggctcttcccgccgagctggacaacttcatc
cagggtgcaggtgaatcgggcgttatctacttctcacttggaaccaatgtcaagagcaaa
tccctatccgaggatcgccgaaaagtgttgctcgagacattcgccagtttgccacagcga
gttctttggaaattcgaggacgagcagctgccggggaaaccatcgaatgtgtttataagc
aaatggttctcgcagcagtccatcctggcccatcgcaatgtaaaactcttcataacccac
ggtggcctactgagcaccattgagagcattcatcacggaaagcccatgttgggtttgccc
tgtctctttgatcagttccgaaatatggcacatgtccagcaaatgggtcttggtttggtt
ctcaacataaaggaaatgaccagtgaggatttcaattcgaccattagacggctgctaacg
aataagactttcgaggagacggcgaggatcacggcggccagacatcgggatcaacctatg
aagcccctggacacggcgatctggtggaccgagtatgtcctgcggcacaagggagctgct
cacatgcaggtggccggcaaggacttggacttcgtaaggtaccacagcctggatgtattc
ggcacctttttaattggcgctctaggtttgccagtagtcattattttttgtatctatgtt
attttaaggaaatgcatcttacaaaaaaaggatacaaatgaggcaataaagaagatgcag
taa

DBGET integrated database retrieval system