KEGG   Drosophila yakuba: Dyak_GE23367Help
Entry
Dyak_GE23367      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dya  Drosophila yakuba
Pathway
Autophagy - animal
Longevity regulating pathway - multiple species
Wnt signaling pathway
Hedgehog signaling pathway - fly
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE23367
   04341 Hedgehog signaling pathway - fly
    Dyak_GE23367
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dyak_GE23367
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dyak_GE23367
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dyak_GE23367
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dyak_GE23367
Messenger RNA biogenesis [BR:dya03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dyak_GE23367
Chromosome [BR:dya03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dyak_GE23367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 356 aa AA seqDB search
MGPQPEQGHMHFSPKVDYILILDKLREDFNKKFATNTPSPCTGLDDYEIKATLGSGSFGK
VQLVRERESGIYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGSLRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccagccggagcaagggcacatgcacttcagtcccaaggtggactacattctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacacgccatcgccc
tgtacgggattggatgactacgagattaaggcgaccctcggatccggatcctttggcaag
gtgcagttggtgcgggagcgcgagtccggcatctattacgcatccaagcagctcagcaaa
gatcagatcgtgaagaccaaacaggtgagccacgtgatgagcgagaagaacgtgctgcgt
tcgatgacgttcccgaatacggtcaacctgattgcctcctacaaggatttcgacagcctc
tacctcgtccttccactgattggtggcggagagctcttcacctaccaccgaaaagtgcga
aagtttacggaaaaacaggctcgtttctatgccgcccaggtgtttttggctctggagtat
ctgcatcattgcagtctgctctacagagacctcaagccggagaacataatgatggataag
aacggatacttgaaagtaaccgatttcggatttgccaagaaagtggaaacccgtacgatg
actttgtgcggcaccccggagtacctgcctccggagattatccaatcgaagccgtatggc
accagcgtggactggtgggcttttggcgtactggtctttgaattcgtcgccggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgtgaggcggac
tacaagatgcccagttacttcagtggatctctgcgccatttggtggaccatctgctgcag
gtggatctctccaagcgttttggcaacctgatcaacggcaaccgggacatcaaggagcac
gagtggttcaaggatgtggagtggataccgctcctcaatcagacagtaaacgcgccctat
gtgcccaacatcagcaatcccgaggacatatccaacttcgataaggtctctgacaagccg
cggcccaaggccaaaaccatgcgacacgaggaagccttcgcggacttttag

DBGET integrated database retrieval system