KEGG   Drosophila yakuba: Dyak_GE23367Help
Entry
Dyak_GE23367      CDS       T01068                                 

Gene name
dyak_GLEANR_7160
Definition
(RefSeq) GE23367 gene product from transcript GE23367-RA (EC:2.7.11.-)
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 356 aa AA seqDB search
MGPQPEQGHMHFSPKVDYILILDKLREDFNKKFATNTPSPCTGLDDYEIKATLGSGSFGK
VQLVRERESGIYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGSLRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccagccggagcaagggcacatgcacttcagtcccaaggtggactacattctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacacgccatcgccc
tgtacgggattggatgactacgagattaaggcgaccctcggatccggatcctttggcaag
gtgcagttggtgcgggagcgcgagtccggcatctattacgcatccaagcagctcagcaaa
gatcagatcgtgaagaccaaacaggtgagccacgtgatgagcgagaagaacgtgctgcgt
tcgatgacgttcccgaatacggtcaacctgattgcctcctacaaggatttcgacagcctc
tacctcgtccttccactgattggtggcggagagctcttcacctaccaccgaaaagtgcga
aagtttacggaaaaacaggctcgtttctatgccgcccaggtgtttttggctctggagtat
ctgcatcattgcagtctgctctacagagacctcaagccggagaacataatgatggataag
aacggatacttgaaagtaaccgatttcggatttgccaagaaagtggaaacccgtacgatg
actttgtgcggcaccccggagtacctgcctccggagattatccaatcgaagccgtatggc
accagcgtggactggtgggcttttggcgtactggtctttgaattcgtcgccggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgtgaggcggac
tacaagatgcccagttacttcagtggatctctgcgccatttggtggaccatctgctgcag
gtggatctctccaagcgttttggcaacctgatcaacggcaaccgggacatcaaggagcac
gagtggttcaaggatgtggagtggataccgctcctcaatcagacagtaaacgcgccctat
gtgcccaacatcagcaatcccgaggacatatccaacttcgataaggtctctgacaagccg
cggcccaaggccaaaaccatgcgacacgaggaagccttcgcggacttttag

DBGET integrated database retrieval system