KEGG   Drosophila yakuba: Dyak_GE23385Help
Entry
Dyak_GE23385      CDS       T01068                                 

Definition
GE23385 gene product from transcript GE23385-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dya00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dyak_GE23385
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dyak_GE23385
Peptidases [BR:dya01002]
 Metallo Peptidases
  Family M67
   Dyak_GE23385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 420 aa AA seqDB search
MSKAVNNMSMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQRE
YEQFLASKEAERVKELERERERERERQRQKEKEKAGSSAIPSLIPANLHVLIDEGNQPSA
PDLGLLDQVVYPNDFPTGANRSLPGSGLLLPAASEAAADKTANAKPSFDRNQKPSYNRTD
SLLAGSLRLVHVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGT
PDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVC
APKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLRR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaataacatgagcatgggcgacgtggagccgcaggagcggatgaag
cacctgtcgcactgcggcaacctgatcgaggtggacaagaacatgccagtcacgcggtac
taccgctctggcaccgagatgctgcgcatggccaatgtttacctgcgggagggcaaccac
gagaacgccttcatcctgtacttgcgctacatgaccctcttcatcgagaagatccgccag
cacccggattacggcagcgtcaaggccgaggtgcgggatatcaacaggaagattaaggac
gagattatgcccacgacggagaaactgagggccaagctactaacgcactaccaacgggag
tacgagcagttcctggccagcaaggaggcggaacgggtcaaggagctggagcgcgaacgg
gagcgggaaagggaacgtcagcggcagaaggaaaaagagaaggcaggctcaagcgccatt
ccatcgctcatcccggccaatttgcatgtgctcatcgacgagggcaaccagccatcggct
ccggacctgggcctgcttgaccaggtggtctaccccaatgactttcccacgggcgccaat
cgcagcctgccgggctccggactcctgctccccgctgccagcgaagcagccgccgataag
acagccaacgccaagccgagcttcgatcgcaaccagaagccatcttacaaccgcacggat
tctctgctggctggctccttgcgccttgttcacgtgcccggtgacacaatggaggtcttt
ctgaagctggcgcttgccaacacctcgaagaacatcgagacatgcggcgtactggctggt
catctgtcccagaaccagctgtacatcactcacatcatcacgccgcaacagcaaggtact
ccggacagctgcaacacgatgcacgaggagcagatattcgatgtgcaggaccagatgcag
ctgataacgctgggatggattcatactcatcccacccagacggcgtttttgtcctccgtt
gacctgcatacgcactgctcctatcagattatgatgcccgaagccttggccattgtgtgc
gcgcctaagtacaacaccactggtttctttatactcacgccacattacggcctggactac
atagcccagtgtcggcagtcgggctttcatccgcatcctaatgacccgccgctcttcatg
gaggcgcagcacatccgaatggataaccaggccaagatcaaggtcatcgatctgcggaga
tag

DBGET integrated database retrieval system