KEGG   Drosophila yakuba: Dyak_GE23402Help
Entry
Dyak_GE23402      CDS       T01068                                 

Definition
GE23402 gene product from transcript GE23402-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dya  Drosophila yakuba
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dyak_GE23402
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dyak_GE23402
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dyak_GE23402
Lipid biosynthesis proteins [BR:dya01004]
 Desaturase
  First
   Dyak_GE23402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 334 aa AA seqDB search
METTKVKERDHSGDSIHKKRDAIWPLVLFYIHLNILGVYGIYVLLTSASWATILFTAMLT
LLGTLGVTVGVHRLWAHRTFTAFKPLKVFLMFCQTTAGQGSIYSVVQAHRLHHAKFQQDE
DPYYSKHSFMYAQVRGGLLKYSPQQEELLKDVDMSDLESDPVVMFQKRFYVLLYIFLNVL
LSVNTPFQYFGDSLATSMFVGFWLRSLIVINLGNLVHSSHFIWSIHKGFKPTDSNSIFLI
TKSYWPQYHYLLPRDYQSGEYGNYASGIGSSMIRVFAALDWAKDLKTIGSVAVRLGLTKA
VETGRPIVECIEEQVELEENALPANHFLNREKFM
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaactaaagtgaaggagcgggatcatagtggtgactccatacacaagaaacgc
gatgccatctggccgctggttctcttctatatccacttaaatatcctcggcgtctacggg
atttacgtgctgctcaccagcgcttcgtgggccacgattttattcactgccatgctcact
ctgcttggcaccttgggcgtcacggtgggcgtgcatcgtctttgggcgcacaggaccttc
accgccttcaagcccctgaaggtgttcctcatgttctgccagacgaccgccggtcagggc
tccatctacagcgtggttcaggcccatcgcctccaccatgccaaattccagcaggacgag
gatccctactacagtaagcacagctttatgtacgcccaggtgcgcggtggcctgctgaag
tactcgccgcagcaggaggaactgctcaaggatgtggacatgtcggacctggaaagtgat
cctgtggtcatgtttcagaagagattctatgtcctgctgtacatcttcctgaacgtactg
ctctcggtgaacactccgttccagtactttggcgactccctggccacctccatgtttgtg
ggcttctggctgcgcagtctgattgtcatcaacctgggaaacctggtgcactcatcccac
ttcatttggagcattcacaagggcttcaagcccaccgattccaacagtatctttctgatc
accaagagctactggccgcagtaccactatctgctaccccgggattaccagagtggggag
tatggaaactatgcctccggaattggttcctccatgatccgtgtgtttgccgcgctcgat
tgggccaaggatctgaagaccattggatccgtggctgtgcgcctgggactgaccaaggcg
gtggagacgggtcgtccgattgtcgagtgcatcgaggaacaggtggagttggaggaaaac
gccctgcccgccaatcatttcctcaaccgggagaagttcatgtaa

DBGET integrated database retrieval system