KEGG   Drosophila yakuba: Dyak_GE23789Help
Entry
Dyak_GE23789      CDS       T01068                                 

Definition
GE23789 gene product from transcript GE23789-RA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dyak_GE23789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 342 aa AA seqDB search
MDKENRPGHHVKKLPLGDQGEKSLKLPDILRALNLIRINKESSANVQEDPVENITEPGSK
SAHTSKIRKLQIGRYEIETTSSSPYPELNDKVPIIYVCEFCLKYMYLRKSYSYHLFHCKK
RRPPGSLVYRKDAIHIYEVDGNKEKLYCQCLCLMAKLFLKNKETLYSPKLLFFYILCLKD
KDGEHLVGYFSRDKKSNSNVNLNCILVLPPYMRKGYGKLLIALSYEISRKEGVIGGPQKP
LSDVGSLCYLSYWGHILLEWLRHHTSPDRITIEELSKATGFVKEDVILTLKFMKIRTYYT
DDHILYTTPTIIENRRRHANFKKPKLSIQKKCLVWKTATSRK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggaaaacagaccaggtcaccatgtgaagaaactgccgttgggcgatcagggg
gagaagagtctaaaattgccggacattctgagagccctgaatttgatcagaataaataag
gagtcctcggcaaatgtgcaagaagacccagtagagaatataacagaaccgggatcaaaa
tctgcccatacaagtaaaattagaaagttgcaaattgggcgctatgagatagaaaccacg
tcttccagtccgtatcctgaattaaacgacaaggtgcccatcatttacgtttgtgagttc
tgcctgaaatacatgtacttgcggaaaagctactcctaccacctattccattgcaagaag
aggcgtccgccgggcagcttggtataccgaaaggacgcaattcatatctacgaggtcgat
ggcaacaaggagaagctgtattgccagtgcctctgcttgatggccaagctctttctgaaa
aacaaagaaacgctctacagcccgaaactgttattcttttatatcctgtgcttaaaggac
aaggatggcgagcaccttgtaggttacttctccagggacaagaagtctaactccaatgtc
aacctaaattgcatccttgttctaccgccctatatgcgcaagggttacggaaaactgctg
atcgccctcagctacgagatctctcgcaaggagggagtcatcggaggtccccagaagccg
ctctcggatgttggcagtctttgttacctcagctattggggccacatcctcctcgaatgg
ttgaggcaccacacctcgccagaccggataaccatcgaagagctgagcaaggcgaccggc
ttcgtcaaggaggacgtaatactcactctaaaatttatgaaaataaggacgtactacaca
gatgaccacatcttgtacactactcccacgataatcgaaaatcgccgtaggcatgcgaat
tttaaaaaaccgaagttgagcattcaaaaaaagtgcctagtctggaagacagccacatca
cgaaagtag

DBGET integrated database retrieval system