KEGG   Drosophila yakuba: Dyak_GE23813Help
Entry
Dyak_GE23813      CDS       T01068                                 

Definition
GE23813 gene product from transcript GE23813-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 543 aa AA seqDB search
MSNEFSELIALGCPDLAAQKPQGSSTQVELILNTERRLSIKQMTATDLATLRATAAAEAE
ARSRAQAEAEARAIAQEQLRQAREAESKARARAALEVQAQLQRVMESEKRRQQEDEERRS
RQQADEEQEDDEDEEEELAKGSLPTNSGPRERVASLPCNVDDAMEMHLLSVSQPKASSKD
DSPPKKSTSHIADSIELLRMQRAARDARSHNRTRERSISPERNHERSAAPDRLQSSVSMS
SLDSASVSASASRQPSKADSRRGSTTSATGVEPPLMAAPPPQPTKFPLTKTVSAPNMNRR
RSSLTSLFPGPSPLVAPEPSLHTNPDPKVQEQLEEDRRRRRMDDGYREIPSGKMVHRTKT
PPPVGTNLGVSLKRVTAPSGSIAIKPKESPMLGVVLRRVEKKAVPQKSILDDDKPLYHFS
IVRSDHKEHVPAQKPKPKPAPPAAKPSPGGILTGPQVVRTAPKQPVPAKPQRPMPGVPIT
ITKIEGDKIIIIKKIIVPKNSKIPEQYLQVGRRRVGDRLVVSVVRLVFVWCLHPSVFCSK
SVL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaatttagcgaactaatcgcccttggctgtccagaccttgcggcacaaaag
ccgcagggcagcagcacccaggtggagttgatccttaacactgagcgtcgcctgagcata
aagcagatgacggccaccgatttggccaccctaagggcgacagcagccgcggaagcggag
gccagatcgcgagcacaggcggaggcggaagctcgggcaattgcccaggaacaattgcgt
caggcccgcgaggccgagtccaaggccagagcacgtgctgccctcgaggtgcaggcccag
ctgcagcgggtgatggagagcgagaagcgcaggcaacaggaagatgaggaacggcgcagc
aggcaacaggcagatgaggagcaggaggatgatgaggacgaagaagaggaactggccaag
ggttcccttccaaccaattcaggcccaagagaacgcgttgcttcgctaccctgcaacgta
gatgatgccatggagatgcaccttcttagcgtttcgcagcccaaggcctcatccaaggat
gattcaccgcccaagaagagcacctctcacatagctgactccattgagctgctgagaatg
cagcgagctgctcgcgatgcccgatcccacaatcgcactcgagagcgttccatatcgcca
gaacgtaaccacgaaaggagcgctgcaccagatcgcctccagagctccgttagcatgagc
agtttggactcggccagcgtcagtgcatcggcatccagacagcccagcaaggcagacagt
cgacgtggtagcaccacgagtgctaccggtgtggaaccaccacttatggcagcacctcct
ccccagcctaccaaattcccactcactaagacagtgtcagcgcccaatatgaatcgcagg
cggagcagtctgacttcgctcttccctgggccatcgcctttggtggcacccgaaccatct
ctgcacacgaatcccgatccaaaggttcaagaacagctagaagaggatcgtcgtcgccgg
cgaatggacgatggttaccgtgagatacccagtggaaaaatggtgcatcgaacgaagaca
ccgccgccagtgggcacaaacctcggtgtgagcctcaagcgggtgacagcgcccagtgga
tcgatagccatcaagcccaaggagtcgcccatgctgggagtcgttctgcgtagagtggag
aagaaagctgtaccgcaaaagagcattcttgatgacgacaaaccactgtaccacttctcc
attgtgcgcagcgaccacaaggaacacgtgcctgctcagaagcccaaaccgaagcctgct
cctccagctgctaagccaagtcccggtggcatcctaactggaccccaagtagttcgaacc
gctcccaagcaacctgtgcccgccaagccacagcgccctatgcccggcgtacccatcaca
attacaaagatcgagggcgacaagatcatcatcatcaagaagatcattgtgccgaagaac
agtaagataccggagcagtatctgcaggttggtcgtcgtcgtgttggtgatcgccttgtg
gtgtctgtagttcgtctggtgttcgtttggtgtctccatccttctgtgttttgttcgaaa
tctgttttatag

DBGET integrated database retrieval system