KEGG   Drosophila yakuba: Dyak_GE23814Help
Entry
Dyak_GE23814      CDS       T01068                                 

Gene name
dyak_GLEANR_7568
Definition
(RefSeq) GE23814 gene product from transcript GE23814-RD
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dyak_GE23814 (dyak_GLEANR_7568)
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dyak_GE23814 (dyak_GLEANR_7568)
Spliceosome [BR:dya03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dyak_GE23814 (dyak_GLEANR_7568)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 2073 aa AA seqDB search
MSNEFSELIALGCPDLAAQKPQGSSTQVELILNTERRLSIKQMTATDLATLRATAAAEAE
ARSRAQAEAEARAIAQEQLRQAREAESKARARAALEVQAQLQRVMESEKRRQQEDEERRS
RQQADEEQEDDEDEEEELAKGSLPTNSGPRERVASLPCNVDDAMEMHLLSVSQPKASSKD
DSPPKKSTSHIADSIELLRMQRAARDARSHNRTRERSISPERNHERSAAPDRLQSSVSMS
SLDSASVSASASRQPSKADSRRGSTTSATGVEPPLMAAPPPQPTKFPLTKTVSAPNMNRR
RSSLTSLFPGPSPLVAPEPSLHTNPDPKVQEQLEEDRRRRRMDDGYREIPSGKMVHRTKT
PPPVGTNLGVSLKRVTAPSGSIAIKPKESPMLGVVLRRVEKKAVPQKSILDDDKPLYHFS
IVRSDHKEHVPAQKPKPKPAPPAAKPSPGGILTGPQVVRTAPKQPVPAKPQRPMPGVPIT
ITKIEGDKIIIIKKIIVPKNSKIPEQYLQMSEDAGKPANTVPSAVSSSAAPTPSLRSKEE
SQPAMQKPTPPPASGQQFFQVVSPQFASVLSSSIPETKCAVRSPISSPLAIRKSRPPLLP
ASPKSTPPLPRKHHPLAYNAATGTISSASGAALPSRLMATIASSPASSISLSSCSSPSSS
PPPPVPCRAPKNASKPVAAAAASLPSTSNEISLDKLLQQQQELEEKSAAATNSAKMDANF
YDAEIEMMNKYLKSLPDYSELDRKLHQEFQECEDLYDKIKRQQQPLAKSNSQQSVTKAVG
PGVPAISSGLSKSSSINFAQNPSSRGAAPRLAYPSIFSQAGGEPKLQRSISSSNMPLSAP
TPMRPLPTKNGLQSGSNLSLNKQLMNEFWSENLTSSQKRQTPKRTFWNYEKICGAQLGDA
GQPFKVDAKTAKKLAIFDPTVAEAAQKELQRPQQSQVPQNHPHKLQKNASLSHLDLKVRQ
AVTKDDLYKLICNEQSPLAGSNFVSRVPVKQQLPVQQQQVLPKSMSMTHVPGGGQPMGAP
LLRTSSRTHIPCYMKNLPSLSRSTSNSAILMSQPRKEPPPKEPLKAPAPLPALAAAPPTV
SKPSGVLKSSSSSCVPSPRCAAAFFRRPQEANNPQQQHHQPLQKPQQVAPIEESGPGDSA
SLERKSEKSNSTISTSSFTVTNCCTTHLPQLSKFTSSFHIAPTTATTTAATTTPTPTAAA
TTSDHQQQQQQQQQSGAVAAMPSVSAQLEVPTSSSSSAATKRQKDVDNKLEKCLNDMLKL
KTSGNSNSTSINNNNAIMSQSLTGEHKDPKTALEGPTSSSSSSSKYVGESQIPVPVQLYD
PQKPLLQQQQQQQRICYPIGKSNSTSQLPMGGYQRLLQQQQQQQQQHQHQHHPQQQQQQQ
QEQQQYPQHKRPFLNWNSFACSAMNGASDPFMQQQHMPAHQQQQHLPHKLQQSYSSSHLP
KQAPKSGLAMFLQKNTTNKENKFGQPLQQQPPGMMPQMYGYQAQQAQQQSKMSYPRTGAP
LTHSASFSSAQRPTALQFHQQHQQQQQQLQQQQQHPQQQQQQHSSFGLGMMSRNYYNVPK
QPERKPLQTFDPYAYPKPNQMQPVKYQQHQQQQPHPHTQFMNASAGGGGGGGGGAAGLQY
DPNTSTQLFYASPASSSSNKQPQQPQQQQQQQQQQSQLQQSNSVIFNHSGQQHQSHQQQQ
NEMSKSALGLHFIETAKPVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDM
ERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFE
MLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYT
SHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDV
WSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFYHGKL
DWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFF
DRLPPHHRVGEVSNKQPLSSGSSSRERSHSLSR
NT seq 6222 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaatttagcgaactaatcgcccttggctgtccagaccttgcggcacaaaag
ccgcagggcagcagcacccaggtggagttgatccttaacactgagcgtcgcctgagcata
aagcagatgacggccaccgatttggccaccctaagggcgacagcagccgcggaagcggag
gccagatcgcgagcacaggcggaggcggaagctcgggcaattgcccaggaacaattgcgt
caggcccgcgaggccgagtccaaggccagagcacgtgctgccctcgaggtgcaggcccag
ctgcagcgggtgatggagagcgagaagcgcaggcaacaggaagatgaggaacggcgcagc
aggcaacaggcagatgaggagcaggaggatgatgaggacgaagaagaggaactggccaag
ggttcccttccaaccaattcaggcccaagagaacgcgttgcttcgctaccctgcaacgta
gatgatgccatggagatgcaccttcttagcgtttcgcagcccaaggcctcatccaaggat
gattcaccgcccaagaagagcacctctcacatagctgactccattgagctgctgagaatg
cagcgagctgctcgcgatgcccgatcccacaatcgcactcgagagcgttccatatcgcca
gaacgtaaccacgaaaggagcgctgcaccagatcgcctccagagctccgttagcatgagc
agtttggactcggccagcgtcagtgcatcggcatccagacagcccagcaaggcagacagt
cgacgtggtagcaccacgagtgctaccggtgtggaaccaccacttatggcagcacctcct
ccccagcctaccaaattcccactcactaagacagtgtcagcgcccaatatgaatcgcagg
cggagcagtctgacttcgctcttccctgggccatcgcctttggtggcacccgaaccatct
ctgcacacgaatcccgatccaaaggttcaagaacagctagaagaggatcgtcgtcgccgg
cgaatggacgatggttaccgtgagatacccagtggaaaaatggtgcatcgaacgaagaca
ccgccgccagtgggcacaaacctcggtgtgagcctcaagcgggtgacagcgcccagtgga
tcgatagccatcaagcccaaggagtcgcccatgctgggagtcgttctgcgtagagtggag
aagaaagctgtaccgcaaaagagcattcttgatgacgacaaaccactgtaccacttctcc
attgtgcgcagcgaccacaaggaacacgtgcctgctcagaagcccaaaccgaagcctgct
cctccagctgctaagccaagtcccggtggcatcctaactggaccccaagtagttcgaacc
gctcccaagcaacctgtgcccgccaagccacagcgccctatgcccggcgtacccatcaca
attacaaagatcgagggcgacaagatcatcatcatcaagaagatcattgtgccgaagaac
agtaagataccggagcagtatctgcagatgagtgaagatgccggcaagccagcaaataca
gtgccctcagcagtttcctcctccgccgccccaaccccaagtctaagatcaaaagaggaa
tcccagccagcgatgcagaaaccaacgccgccgccggccagtggccagcagttcttccag
gtggtctcgccgcagttcgcctcggtgctgtcgtccagcatcccggagaccaagtgcgcg
gtgcgttctccgatatcctcgccactagcaatccggaagagtcgtccacctctgctgccg
gcgagtccgaaatccacgcctccactaccgaggaaacatcatccccttgcctacaatgcg
gcaacgggaacaatcagcagtgcctctggagcagcgttgccttcccggctaatggccacc
attgcctcgagtccggcttcgagtatatcgctatcctcttgtagttccccatcttcatca
ccaccaccgccagtaccatgtcgtgctcctaagaatgccagtaaacccgttgctgctgct
gctgcttcacttccgtccacctcaaacgaaatcagtttggacaagttgctgcaacagcag
caggagctggaggagaaatccgcggcagccacgaacagcgctaaaatggatgccaacttc
tacgatgccgagatcgagatgatgaacaagtatctcaaaagcctgcctgactacagcgaa
ctggacagaaagctgcaccaggagtttcaggagtgcgaagatctctacgacaagatcaag
cgtcagcagcagccgctggccaagtccaactcgcagcaatcggtcacgaaggccgtggga
ccaggagtgccggccatttcctccggcctatccaagtcttcgtcaattaactttgcccag
aatcccagcagtcgtggagctgcaccgcggttggcatatccctcgatattttcacaggct
ggaggcgaacccaagctgcagcgcagcatttcaagttctaatatgcctttgagtgcgcct
actccaatgcgtccgctgcccaccaagaatggactgcaaagtggctccaatctgtccctt
aacaaacagttgatgaacgaattctggagcgagaatcttaccagttcgcaaaagcggcaa
acgcccaagcgcaccttttggaactacgagaagatctgcggtgcccagttgggcgatgca
gggcaaccctttaaggtggatgccaagactgccaagaaattggctatatttgatcccact
gttgcggaggccgctcagaaggaactgcagcgaccacagcaatcacaggtgccacaaaat
catccccacaaactgcagaagaatgcctcgttgtcgcacctggatctgaaggtgcgtcag
gcggtgaccaaggacgatctctacaagctcatctgcaacgagcaatcgccgttggctggt
tcaaattttgtgagtagagtgccggtgaagcagcaactcccagtacagcagcaacaggtg
cttccaaagagcatgtccatgacgcatgtgccgggtggtggtcaacccatgggagcgcca
ttgctgcgaacttctagtcgcactcatataccctgctacatgaagaatctaccctcactg
agcaggagcacatcgaactctgcgatactcatgagccaaccgcgcaaggaacctccacca
aaggaaccactgaaagctccagcaccacttcctgccctagctgctgctccaccgactgta
agtaaaccgagtggtgtcttgaagagctccagcagttcctgtgtcccatcaccgcgttgt
gccgcagccttctttcgccgaccgcaggaagcaaacaatcctcagcagcaacatcatcag
ccacttcagaagccgcaacaagtggcgccaatcgaggaatccggacctggggattccgca
tctctggaacgcaaatcggagaagagcaacagcacgataagcacaagtagctttacggtg
accaactgttgcaccacccacctgccgcagctctccaagttcacctcatcgttccacatt
gcccccaccacagcaacaaccacagccgcaacaacaacaccgaccccgacagcagcagca
acaacaagcgatcatcagcagcagcagcagcaacaacaacagagtggcgcagtagcagcg
atgccatctgtatctgcccagttggaggtgccaacatcgtcatcgtcgtcagcggccaca
aagcgccagaaagatgttgacaacaagctagaaaaatgcttgaacgacatgctaaagttg
aagaccagcggcaacagcaacagcactagtatcaacaataataatgcaatcatgtcgcag
tcgctgacgggcgagcacaaagacccgaagactgcactcgaaggccccacgagcagcagc
agcagcagtagcaagtacgtcggtgaatctcagatccccgtgccagttcagctctacgat
ccgcagaagccgttgctgcagcaacagcagcagcaacaaaggatctgctatcccataggc
aaatctaactctacctctcagctgcccatgggcggctaccagagattgctgcaacaacag
cagcagcagcagcagcagcatcaacatcaacatcacccacagcaacagcagcaacaacaa
caggaacagcagcagtatccgcagcacaagcgacccttcctcaactggaatagctttgca
tgttccgccatgaacggagcgagtgatcccttcatgcagcagcaacacatgcctgcccac
cagcaacagcaacatctgccacacaagctgcagcagtcctactcctcgtcgcatttgccc
aaacaggcgcccaaatctggactggccatgtttctgcagaagaacaccaccaacaaggag
aacaagtttggccagccgctgcagcagcagccacccggcatgatgccccagatgtacggc
taccaggcgcagcaggcccagcagcaatccaagatgagctatccccgcaccggtgcccca
ctgacgcactcggcctccttcagctccgcccaaaggccgacggccctgcagttccatcag
caacatcaacagcagcagcagcagctgcagcaacagcagcaacacccccagcagcaacaa
cagcagcattccagctttgggctgggcatgatgagtaggaattactataatgtgcccaag
cagccagagcgcaagccgctgcagaccttcgatccgtatgcctatcccaagccgaatcag
atgcagccggtcaagtaccagcaacatcagcagcagcaaccgcatccgcatacgcagttt
atgaatgcttccgctggaggaggaggaggtggcggtggcggtgccgctgggcttcaatac
gatccaaatacaagtacgcaattgttttacgcgtcgccggcgtcatcgtcatcgaacaag
caaccgcagcaaccgcaacagcaacagcagcagcagcagcaacagtcgcagctacaacaa
agcaattctgtcatattcaatcactcgggccagcaacaccaatcacatcaacagcagcag
aatgaaatgtccaagtccgcattgggactgcacttcatcgagacagcaaagcccgtcatt
caagatgatgctgatggtcacttaatttaccacaccggagacattctccatcacagatat
aagatcatggccacactgggcgaaggaacttttggacgtgtggtcaaggtcaaagatatg
gagcgtgattactgcatggccttaaagattattaagaacgtggaaaagtaccgcgaagct
gccaagctggagataaatgctttggaaaagattgcccaaaaggatccgcattgcgatcat
ttgtgcgtgaaaatgattgactggtttgattatcatggacacatgtgtatagtttttgaa
atgttgggacttagtgttttcgattttttgcgagagaacaactatgagccatacccgctg
gaccaagtgcgccacatggcctatcaattatgctattctgtgaaatttctacatgacaat
cgtttaacgcacaccgatctcaagccggagaacatactcttcgtcgactcggattatact
tctcactataatcataagattaaccgcgaggtgcgccgcgtcaagaacacggacgttcgc
ctgatcgactttgggtcggccaccttcgaccacgagcaccacagcacaattgtctcgacg
cgacattaccgcgcgccagaggtcatactggagctggggtggtcacagccgtgtgacgtt
tggtccattgggtgcatcttgttcgaactgtatctgggaatcacgctcttccaaacgcac
gacaatcgcgagcacctggccatgatggagcgaatcttgggacaaataccatatcgcatg
gcacgcaatcatactctttatagcaaaaccaaaacaaagtacttctatcatggtaagttg
gattgggatgagaagtccagtgcgggtcgctacgtccgtgatcactgcaagccgttgttc
ctgtgccagctgagcgacagtgaggaccactgtgagctcttcagtctgatcaagaagatg
ctggagtacgagccctcgtcacgcatcacgttaggcgaagccctgcatcatccttttttc
gacaggctgccaccgcaccatcgagtgggtgaggtcagcaacaagcagccgctttcgtcg
ggcagcagcagccgcgaaaggtcgcacagtctctccagatga

DBGET integrated database retrieval system