KEGG   Drosophila yakuba: Dyak_GE23847Help
Entry
Dyak_GE23847      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11832  ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Pathway
dya03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dyak_GE23847
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE23847
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE23847
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dyak_GE23847
DNA repair and recombination proteins [BR:dya03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     Dyak_GE23847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 6538069
NCBI-ProteinID: XP_002098604
FlyBase: FBpp0268857 FBgn0240997
UniProt: B4PQ47
Position
3R
AA seq 1094 aa AA seqDB search
MHEYDVNERKEEPASLPPTQHETTDTVGQSQDPHNDTTEVNSQLPQDQRNQEQENPIPQQ
DNSQPLQEKPTKQQQQQEDTLEVSILYPLVVFEQVAVTQPILIADTPKRSPVKKRQRRVY
VADTLRCSSLRSRQEPATKDPLEGGLKQPEVAPPPPPVQPPSPTPTESIEYTPPELFNPE
VWNNIEEAQEPKSVGKKRRAAGGIKRTRGNKLLREIEIYSPETAAAIAAAQAELNAAGKS
GAAGARASRKRTNTMSLYDRRFQTTTDERRVANGYGGNAARSGTGSSSNEIESQELQSHQ
YYGPNGGSSSAGAGSGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHSLH
HLIQDLNVVQQTIVRQQTARSASLGRNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNS
GNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQ
DAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDNGESQDRTDSTASQNLS
SGNGSLATSQITTTKTSFFSRKSKRKDEVKSSKSTRVQSPLKDNSPTASGITGAGTAHAT
ANSLFYLNTVDLSGASSTSGSASTSASGVAPTSVALPTLPQTTKYSSDDEMNSATVLKDK
MRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNSDLQ
DKPNTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEK
VSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASD
YVNCPKDRRNTMTNSQTMTSQTVASNENAAPNNGSSSVASTPVIAAASALASSGNILMKK
MKFGRSKASSSGDMSKNVKQVNGTSSKNITNGIGKLSMNTTCQAVNCCAMRLCCSQQTSS
SNSASCSDFSEESLQNGSNSNLSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCD
DDKIKAMTQREFEELLSPTRKITITPYLLFYARFDLQPQKTTPPKPGSSSTPPPPSSAQS
SWSNENMPSGSHKI
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacgtaaatgagcgcaaagaggaaccagccagtcttccacccactcaa
cacgagaccactgacacggtcggccagagccaggatccacacaacgatacaactgaagtt
aacagccagctaccacaggatcagcgaaatcaggaacaggagaatcctattccgcagcag
gataacagccagccgcttcaggaaaagccaactaagcagcagcaacagcaggaggacaca
ttggaagtttccattctttatcctttggtagtcttcgagcaggtggcggtcacccaaccg
attctgattgcggacacaccgaagcgatcgccagttaagaagcgccagcgtcgcgtttat
gtcgccgacaccttgcgctgctccagcctacgttcccgtcaagagcccgcaaccaaggac
ccactggaaggtggcctaaagcagccggaagtcgctccaccaccaccgcctgttcagccg
ccctcgcccacgccgacggagtccattgaatacacacctccagaactttttaatccggag
gtttggaacaacattgaagaggcccaggagccgaagtcggttggaaagaagcgacgtgcc
gctggaggaatcaaaaggacgcggggcaacaagcttctgagagagatcgagatctattcg
ccggaaacggcggccgctattgcggcagcacaggccgaactcaacgccgcaggaaagtcg
ggagcagcaggagcacgggccagccgcaagaggaccaacacgatgtctctatacgatcgg
cgattccagacgaccaccgatgagcgccgcgtggctaacggatacggaggcaatgcagcg
cgatcgggcaccggctcctcgtcaaacgagatcgagtcccaggagctgcagagccatcag
tattacggtcccaacggtggcagtagctctgcgggagcaggctcaggcttgaacggaagt
gcggcggccctgaaccatgccccttctatgggcacactgtgcaacataggcaacagttgc
tacttgaattcggtggtttacaccctgcgctttgccccgcactttttgcacagcctacac
cacctgatacaggacttgaatgttgtgcagcagacgattgtgcgccagcagacggccagg
tctgcgtcactcggtagaaatgtgagtgccgctcagttggagcatgcccgcagttggagc
agcaaagatctggccaccagtacggatcagtacagcggccagaatggcggagttaatagc
ggaaatggtggaagcggttcgagcaagtcgacccatcagtcggtaaccgaaaagctccac
gaactgtataacaacctgcacggcaacgagatggcagactccacggagccctaccacgcg
gatacgctgctgcacgccatccaggacgtaaacgccacctttgagggcaatcagcagcag
gacgcacacgaattcctaatgtgcgtgcttaattgcatcagggaaacgaatcagtctttg
atcaaggccattggcgagtgtccggaggtcatcgcaaacgggtacattgccaacccggat
gaagtcgacaacggagagagccaggatcgcacagattcaactgcgtcgcagaacctgagc
tccggcaatggatcgctggcaactagtcaaataaccacgaccaaaacgtcgttcttctct
cgcaaatcaaaaagaaaagacgaggtcaagtcatccaagtcgacgcgcgttcagtcgccg
ctcaaggacaatagtcccacggcgagcgggataaccggagcgggcacagcccatgccacc
gccaacagcctgttctacctgaacacagttgatctcagcggcgccagcagcaccagcgga
agtgccagtacgagtgccagtggcgttgctcccacaagtgtagcgctgcccacactacca
cagactacaaaatactccagtgacgacgagatgaattcggccaccgtgctgaaggacaaa
atgagactggaggagcgaatacgtgagcttaacctgaacttcttcagctccgacttcgag
ggcattgtggtgctgaccaccaagtgcctcagttgcgagacgatcacgcggcaaaagcag
ggcatgcttgatatttctgtgccggtgccgatctcgggatacgacaattccgatctccag
gacaaacctaacacatatatacagaattcctgcattacgaaggagtatttccgcggagag
aataagtatagttgcaaccagtgcaccggctacaccgaagccatccggtccatctcgtac
gaggtgctgccccggctactggtcatacagctgaatcgtttctctggcggcatggagaag
gttagtacgtacgtgcctaccaccttcacgctgccctgtttttgcgccacctgctgtgag
ctgggcgaaggcaacaagctgcacgtttacaagctgtacagcgtgatcacgcatgtggga
gccaccctgacggtgggccattacatcgcgtatacgtgcttcttggatcttgccagtgac
tatgtgaactgcccgaaggatcgacggaatacgatgacgaactcgcaaacgatgacttct
caaacagtggcgtccaatgagaatgctgcgccaaacaatggaagcagctccgtagccagc
actccagttattgcagcagcttcggccttggcctcctcgggcaacattttgatgaagaag
atgaagttcggtcgcagcaaggcctccagcagcggtgatatgagcaagaacgttaagcag
gttaatggaacgagcagcaagaacatcaccaatggaattggaaagctcagcatgaacacc
acctgccaggcagtcaactgctgtgccatgaggctctgttgcagccagcagacgagcagc
agcaattcagccagttgcagcgatttcagcgaggaatccctgcaaaacggcagcaacagc
aatctcagcttcggtggatcgggcagcacctatcccacgggctacggaagcacgggtcgt
ggtggtgtcagagccaactacgcccacggaggtccggatcccatttggtacatgtgcgac
gacgacaagatcaaggccatgacccaaagggagttcgaagaactgctatcccccactcgg
aagatcacaataacgccctatttgctgttttacgcgcgattcgatctgcagccgcagaag
acgacaccgccgaagcctggatcatcctcaacgcctccgccaccgtcgtcggcacagagt
tcttggtcgaatgaaaacatgcccagcggctcgcacaagatttga

DBGET integrated database retrieval system