KEGG   Drosophila yakuba: Dyak_GE23847Help
Entry
Dyak_GE23847      CDS       T01068                                 

Definition
GE23847 gene product from transcript GE23847-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dyak_GE23847
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE23847
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE23847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1094 aa AA seqDB search
MHEYDVNERKEEPASLPPTQHETTDTVGQSQDPHNDTTEVNSQLPQDQRNQEQENPIPQQ
DNSQPLQEKPTKQQQQQEDTLEVSILYPLVVFEQVAVTQPILIADTPKRSPVKKRQRRVY
VADTLRCSSLRSRQEPATKDPLEGGLKQPEVAPPPPPVQPPSPTPTESIEYTPPELFNPE
VWNNIEEAQEPKSVGKKRRAAGGIKRTRGNKLLREIEIYSPETAAAIAAAQAELNAAGKS
GAAGARASRKRTNTMSLYDRRFQTTTDERRVANGYGGNAARSGTGSSSNEIESQELQSHQ
YYGPNGGSSSAGAGSGLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHSLH
HLIQDLNVVQQTIVRQQTARSASLGRNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNS
GNGGSGSSKSTHQSVTEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQ
DAHEFLMCVLNCIRETNQSLIKAIGECPEVIANGYIANPDEVDNGESQDRTDSTASQNLS
SGNGSLATSQITTTKTSFFSRKSKRKDEVKSSKSTRVQSPLKDNSPTASGITGAGTAHAT
ANSLFYLNTVDLSGASSTSGSASTSASGVAPTSVALPTLPQTTKYSSDDEMNSATVLKDK
MRLEERIRELNLNFFSSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNSDLQ
DKPNTYIQNSCITKEYFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEK
VSTYVPTTFTLPCFCATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASD
YVNCPKDRRNTMTNSQTMTSQTVASNENAAPNNGSSSVASTPVIAAASALASSGNILMKK
MKFGRSKASSSGDMSKNVKQVNGTSSKNITNGIGKLSMNTTCQAVNCCAMRLCCSQQTSS
SNSASCSDFSEESLQNGSNSNLSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCD
DDKIKAMTQREFEELLSPTRKITITPYLLFYARFDLQPQKTTPPKPGSSSTPPPPSSAQS
SWSNENMPSGSHKI
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacgtaaatgagcgcaaagaggaaccagccagtcttccacccactcaa
cacgagaccactgacacggtcggccagagccaggatccacacaacgatacaactgaagtt
aacagccagctaccacaggatcagcgaaatcaggaacaggagaatcctattccgcagcag
gataacagccagccgcttcaggaaaagccaactaagcagcagcaacagcaggaggacaca
ttggaagtttccattctttatcctttggtagtcttcgagcaggtggcggtcacccaaccg
attctgattgcggacacaccgaagcgatcgccagttaagaagcgccagcgtcgcgtttat
gtcgccgacaccttgcgctgctccagcctacgttcccgtcaagagcccgcaaccaaggac
ccactggaaggtggcctaaagcagccggaagtcgctccaccaccaccgcctgttcagccg
ccctcgcccacgccgacggagtccattgaatacacacctccagaactttttaatccggag
gtttggaacaacattgaagaggcccaggagccgaagtcggttggaaagaagcgacgtgcc
gctggaggaatcaaaaggacgcggggcaacaagcttctgagagagatcgagatctattcg
ccggaaacggcggccgctattgcggcagcacaggccgaactcaacgccgcaggaaagtcg
ggagcagcaggagcacgggccagccgcaagaggaccaacacgatgtctctatacgatcgg
cgattccagacgaccaccgatgagcgccgcgtggctaacggatacggaggcaatgcagcg
cgatcgggcaccggctcctcgtcaaacgagatcgagtcccaggagctgcagagccatcag
tattacggtcccaacggtggcagtagctctgcgggagcaggctcaggcttgaacggaagt
gcggcggccctgaaccatgccccttctatgggcacactgtgcaacataggcaacagttgc
tacttgaattcggtggtttacaccctgcgctttgccccgcactttttgcacagcctacac
cacctgatacaggacttgaatgttgtgcagcagacgattgtgcgccagcagacggccagg
tctgcgtcactcggtagaaatgtgagtgccgctcagttggagcatgcccgcagttggagc
agcaaagatctggccaccagtacggatcagtacagcggccagaatggcggagttaatagc
ggaaatggtggaagcggttcgagcaagtcgacccatcagtcggtaaccgaaaagctccac
gaactgtataacaacctgcacggcaacgagatggcagactccacggagccctaccacgcg
gatacgctgctgcacgccatccaggacgtaaacgccacctttgagggcaatcagcagcag
gacgcacacgaattcctaatgtgcgtgcttaattgcatcagggaaacgaatcagtctttg
atcaaggccattggcgagtgtccggaggtcatcgcaaacgggtacattgccaacccggat
gaagtcgacaacggagagagccaggatcgcacagattcaactgcgtcgcagaacctgagc
tccggcaatggatcgctggcaactagtcaaataaccacgaccaaaacgtcgttcttctct
cgcaaatcaaaaagaaaagacgaggtcaagtcatccaagtcgacgcgcgttcagtcgccg
ctcaaggacaatagtcccacggcgagcgggataaccggagcgggcacagcccatgccacc
gccaacagcctgttctacctgaacacagttgatctcagcggcgccagcagcaccagcgga
agtgccagtacgagtgccagtggcgttgctcccacaagtgtagcgctgcccacactacca
cagactacaaaatactccagtgacgacgagatgaattcggccaccgtgctgaaggacaaa
atgagactggaggagcgaatacgtgagcttaacctgaacttcttcagctccgacttcgag
ggcattgtggtgctgaccaccaagtgcctcagttgcgagacgatcacgcggcaaaagcag
ggcatgcttgatatttctgtgccggtgccgatctcgggatacgacaattccgatctccag
gacaaacctaacacatatatacagaattcctgcattacgaaggagtatttccgcggagag
aataagtatagttgcaaccagtgcaccggctacaccgaagccatccggtccatctcgtac
gaggtgctgccccggctactggtcatacagctgaatcgtttctctggcggcatggagaag
gttagtacgtacgtgcctaccaccttcacgctgccctgtttttgcgccacctgctgtgag
ctgggcgaaggcaacaagctgcacgtttacaagctgtacagcgtgatcacgcatgtggga
gccaccctgacggtgggccattacatcgcgtatacgtgcttcttggatcttgccagtgac
tatgtgaactgcccgaaggatcgacggaatacgatgacgaactcgcaaacgatgacttct
caaacagtggcgtccaatgagaatgctgcgccaaacaatggaagcagctccgtagccagc
actccagttattgcagcagcttcggccttggcctcctcgggcaacattttgatgaagaag
atgaagttcggtcgcagcaaggcctccagcagcggtgatatgagcaagaacgttaagcag
gttaatggaacgagcagcaagaacatcaccaatggaattggaaagctcagcatgaacacc
acctgccaggcagtcaactgctgtgccatgaggctctgttgcagccagcagacgagcagc
agcaattcagccagttgcagcgatttcagcgaggaatccctgcaaaacggcagcaacagc
aatctcagcttcggtggatcgggcagcacctatcccacgggctacggaagcacgggtcgt
ggtggtgtcagagccaactacgcccacggaggtccggatcccatttggtacatgtgcgac
gacgacaagatcaaggccatgacccaaagggagttcgaagaactgctatcccccactcgg
aagatcacaataacgccctatttgctgttttacgcgcgattcgatctgcagccgcagaag
acgacaccgccgaagcctggatcatcctcaacgcctccgccaccgtcgtcggcacagagt
tcttggtcgaatgaaaacatgcccagcggctcgcacaagatttga

DBGET integrated database retrieval system