KEGG   Drosophila yakuba: Dyak_GE23887Help
Entry
Dyak_GE23887      CDS       T01068                                 

Definition
GE23887 gene product from transcript GE23887-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dya  Drosophila yakuba
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dyak_GE23887
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dyak_GE23887
Transfer RNA biogenesis [BR:dya03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dyak_GE23887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 306 aa AA seqDB search
MAAAAPVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIAS
LANKFPTVKIIGEEGGSDLNVCDDWLVNDLDEGFLQQSCPAEWKDVKPEDFVIWVDPLDG
TAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVP
APAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQNHAALVEKIPAEVR
AAVGAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctgccccggtgatcatgcgcgtcatggcgtcctcaattagcaccgccaag
cgggctggaggaatcatccgcgacgtgctcaagaagggcgacctgggcatagtggacaag
ggcaagaacgatccccagacggaggcagatcgctctgcccagcgctgcatcatcgcctcc
ttggctaacaagttccccaccgtgaagatcattggcgaggaagggggatccgatctgaat
gtttgcgacgactggctggtgaacgatttggatgagggattcctgcagcaaagttgcccc
gctgagtggaaggatgtcaaacccgaggactttgtgatttgggtggatcccctggatggc
acagccgagtatacacagggacacgtggaacacgtgaccgtcctgatcggcatagctgtg
aaagatgctgctgtgggcggcatcatacatcagcccttctaccagcagcccgatggcgaa
atgggtcgtaccatttggggcctcaagggtctgggcacgggaggattcacggcggtgccc
gcgccagccggccagttcatcataaccaccacacgctcgcattccaatgccctgcaccag
caagcgctcaatgcattcgcatccacagaagttctgaaagtcggaggcgctgggttcaaa
gtgctccagctgctggagggaaaggcccatgcctacgtcttcgccacgcccggatgcaag
aagtgggacacctgcgcacccgaggccgttctggaggcccagggcggctgcctaaccaac
atcaacggcgagcactacgcctacaatgcggatgtggagcacgtgaatcgccagggagtg
ctggccagtctgggacagaaccatgccgcgctggtggaaaagattccagccgaggtgcgg
gcggcagtgggagccaagtaa

DBGET integrated database retrieval system