KEGG   Drosophila yakuba: Dyak_GE24150Help
Entry
Dyak_GE24150      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17610  calcineurin B homologous protein 1
Organism
dya  Drosophila yakuba
Brite
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dyak_GE24150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RE_XamI
Motif
Other DBs
NCBI-GeneID: 6537510
NCBI-ProteinID: XP_002098056
FlyBase: FBpp0269160 FBgn0241284
UniProt: B4PUW1
Position
3R
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataaatcgtcgcttttcctgcggaacgaggagatcgctcaaatccaggaggag
actggcttcacccccaaccaaattgagcgactttactctcgcttcacctcgttggatcgc
aacgattgcggaaccctgtcccgggaggatctgatgcgaatcccggaactagccattaat
ccgctgtgcgagcgaatagttcactccttctttgctgagagcaatgacgatcgggtgaac
ttccggcagttcatgaacgtactggcgcactttcggccgctgagggataacaagcagagc
aagctcaacagccgagaggagaagctaaagttcgccttcaagatgtacgatctggatgac
gatggtgtgatcagcagagacgagctactgtccatcctgcacatgatggtaggcgcgaac
ataagccaggaccagttggtcagcattgcggagaggacgatcctggaggcagacctttgc
tgccagggtaagatctcgttcgaagacttctgcaaagctctggaccgcactgacgtggac
cagaagatgtctatacggtttctcaactaa

DBGET integrated database retrieval system