KEGG   Drosophila yakuba: Dyak_GE24165Help
Entry
Dyak_GE24165      CDS       T01068                                 

Definition
GE24165 gene product from transcript GE24165-RA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dyak_GE24165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 226 aa AA seqDB search
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDHLKPGAHILDVGSGSGYLTACFYRYIKAKGVDAETRIVGIEHQAEL
VRLSKANLNTDDRSMLDSGQLIIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPDGGSQYMQQYDKDADGKVQMTRLMGVMYVPLTDLRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcgatccgtgggagccaataatgaagacctcatacgccaactgaaggatcac
ggcgtcattgcaagtgatgcggtggcccaggcgatgaaggaaaccgaccgcaagcactac
tctccgcgcaacccctacatggacgccccgcaacccataggtggaggtgtcaccatcagt
gctcctcacatgcatgccttcgccttggagtatctacgtgatcacttgaagcccggtgca
catatactggacgtgggctctggatctggctacctaacagcctgcttctatcgttacatc
aaggctaagggagtcgatgcggagacccggattgtgggcatagagcaccaggcagagctg
gtacgtctgagcaaggccaacttgaacaccgacgaccgtagcatgctggactccggccag
ttgataatcgtcgagggcgacggccgtaagggataccccccgaacgcaccgtataatgca
atccatgttggagcagctgctcccgacacgcccaccgagctcatcaaccaactggccaac
ggcggacgcctcatagttccagtcggtcccgacggcggatctcagtacatgcaacagtac
gacaaggacgctgatgggaaggtgcagatgacacgtcttatgggcgtaatgtacgtccca
cttacagatcttcgctcctga

DBGET integrated database retrieval system