KEGG   Drosophila yakuba: Dyak_GE24187Help
Entry
Dyak_GE24187      CDS       T01068                                 

Definition
GE24187 gene product from transcript GE24187-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dya  Drosophila yakuba
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE24187
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1306 aa AA seqDB search
MERRRFNLSSMSPMADSTRIDASLISNRPTASSFLRGLSLRGSNISLNGTRTPERSLMNR
TATSPSAISRQKLNLSQVDPRTFADVHSSGLASRVVAYHESSLGGRSGLQRSMSASNLYN
PLTQPRRAPASPLPYKSRAPTLSITQIAPPERSFYSGNTLPSLLRSNSLAGVVQKTSEQE
QLSRENRPILHPPHPQHESEPTRSVLEELKEISRKRINTGDTQQPHDFTKRSCQRSADFV
DHHRHQQQLHHLQQQQSQSFKRQRELTVSVPLRHHSTSVSAAPPALQHMHSNGNVSPTQS
PEQVAKRPNCSYSNDIASSLSSSWRHSNKRKLLDMRERFQHSKNDTLVSGGSSPENSPEN
VAKIQRKVDAETVSKALSMPSPAVAAVAAVPASRAISAPPIQKTDQQHSVVVPQVTEKPK
LTLFNARQSQTKAEQPRPDLSSPEVDAGEYAGIQFVKPKQQNSMLGVKNPSVERTHKTKL
AIMLSGLKGELYQGEPDELDAPAPKQTPSPAPLTLPTPIKPIIAPSVTTSTTTVTSTATT
STSAPSKPVILSNQVIKPADVPNTNTTSSVPKLVLGQPAPPAASTEQTPPKPTDKVPAAQ
AEIPAKFELPAKPVTPATSAQPLISFGTPKTTAAPSFSFGNATNTTSSTTTTITNDTTSK
PIFSFGQAPANGPTVGGLPGFKLDTPATTLASTANPGTPVTSTTMFGMAAPKTTATVAPT
TTPSLSFGQPNSAVLGATTCKTTTTATMPSFGAPTTAVKPMFSFGQSGNLSSGTPTTNGN
DAAVAKPPVFSFGGSTTQPATAAPTPVFGSLSKPLGGGFMSPVANKSETTKPGIFGNSDN
GFGNAVKPPANVATTTAAELPKPFGFPATTTAAGAGSSGTNLFTFGGTATSKAAEPAPAS
QNNLFGQSATPSTPFAFGGAAANAGNSGNKDNKSMFAFGGADNNSVAKPSGLFSFGGTDK
PAPPAFGSVTTSVTSATATPTNSAFGFSTAQKPATPMFGSGSTQQSSTPSVAAAKPFTFG
GGTAQPPAPAASTASGGFSFAAVASKNTTEPTATNLFGSPANASKPSFNFGGNTATQTAP
GAAGSPAGGFSFATATKKEDSASTNMFGSPNTGVVKPNFSFSSNNSTTQSAAPTPAPTFG
GFGAPAAAAPAAPSTNQNKPFAFGGSTPASAPSAAPLGGNLFANAVSATQNQPKPGVFSF
GGAKSTPSATAGNAPFSFGGASAGGIASPPSNQGLNTAKPFSFGGAGGTPAPNVFGSPAP
VSQASNPAGGFSFGGASPAQQANAGNLFAPTPESRPIRKATRRLQK
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgctttaacttgagcagcatgtcacccatggcggattccacgcggatt
gacgcgtcgctgataagtaatcgtccgacggccagtagtttcctgaggggactgagtctc
agggggtcgaatatctcgctcaatggcacacgcacaccggagaggtcgttgatgaaccgc
actgccacatcgcccagcgccatatcgcgtcagaaactgaacctcagccaggtggatccc
agaacctttgccgatgtgcatagcagcggactggcatccagagtcgtggcctaccatgag
agcagcttgggaggacgcagtggtctgcagcgcagcatgtccgccagcaatctgtacaac
ccactgacgcagccgcgcagagcgcccgcttccccgctgccctacaagtcaagggcgcca
acgctttcgataacgcaaattgcaccaccagagcgtagtttttattccggcaacacgctg
ccaagcttgttgcgctccaactccttagcaggtgtagtgcaaaagaccagcgaacaggag
cagctttcaagagagaatcgaccaatcttgcacccacctcatccacagcatgagagcgag
ccaacaagaagcgtgctggaggagcttaaggagatctcccggaagcgcatcaatacggga
gatacgcagcagcctcatgactttacaaaaaggagttgccagcgaagtgcggactttgtg
gaccatcaccgtcatcaacagcaactacatcatttgcagcaacagcagagtcagtccttt
aaaaggcaacgagagctgacagtatcggttcccctcaggcatcattcgacatctgtgtcg
gctgcccctcctgcattgcaacatatgcactcgaatggaaacgtctctccaacacaatct
ccggagcaggtggccaaacggcccaactgtagctacagcaacgacattgcttcctcgctg
agttccagttggcgtcacagcaacaagaggaagctgttggacatgcgggaaaggttccag
cacagcaaaaacgacacactagtcagtggaggaagctcacctgagaactcgcccgaaaat
gtggccaaaattcaacgtaaagttgatgcagaaactgttagcaaggcattgagcatgccc
tctccggcagtggcggctgtggcggcagtcccggcttctcgagccatttcggcacctccc
atacaaaagacagaccagcagcattcagtggtggttccgcaggtgacggaaaaacctaag
cttaccctcttcaatgcgcgacagtctcaaactaaagcggaacagccgcgaccggatctg
agtagcccggaagtagacgctggcgaatatgcgggcattcagtttgtaaagcccaagcag
cagaattccatgctgggcgttaagaaccctagcgtagaacgcactcacaaaaccaaactg
gctattatgctgagtggattgaagggcgaactgtaccaaggagagccggacgaactagat
gctccagcgcctaaacaaacgccatcgccagcgcctctgactcttccaacgcccatcaaa
ccgatcatagctccttctgtaaccacatccacaacgactgtaacttccaccgcaactaca
tcaacttctgcccccagcaagccggtaatattaagtaaccaggttataaagccagcagat
gtgccaaacacaaataccactagttcagtgcccaaacttgtacttggtcagcctgcgccg
cccgctgcttcaacggaacaaacaccaccaaaacccaccgacaaagtaccggcagcacaa
gcagaaatcccagccaagtttgagctaccagccaaacccgtcactccagcaacatcagct
caaccactgatcagttttggcacaccgaaaaccacagcagcaccatcattctcatttgga
aatgcgaccaataccactagtagcactactaccactattactaatgacaccacctcaaag
cccatattctcgtttggacaagcgcctgccaatggccccacagtaggcggcctccctgga
ttcaaattggacaccccagcaacgacgctggcgagtactgctaaccctgggacaccagtc
acatctacaactatgttcggaatggcagcgcccaaaacgacggctaccgttgctcccact
acaactccatcgcttagtttcggccagccgaattcagcagtattaggcgccaccacctgc
aagaccactacaacagcaacgatgccatcatttggagcaccaaccacggcggtcaaacca
atgttttcgtttggacaatcgggcaacttaagctcaggaactcccacaaccaacggaaac
gatgctgctgtggccaagccgcctgtattcagttttgggggtagcaccactcaaccagct
actgctgctccgacaccggtatttggaagcctatcgaaaccccttggtggaggttttatg
tcacccgtggccaacaaatccgagacaacaaagcctggcatcttcggcaattcggacaac
ggatttggaaacgcagtgaagccaccagccaatgtagcaacaaccaccgccgccgagcta
cccaagccatttgggttcccagctacaacgaccgcggctggtgctggatcgtcgggcaca
aatctctttacatttggagggacggccacttcaaaagcggcggaaccagctccagcaagc
cagaacaaccttttcggacaaagcgcaactccaagtacgccctttgcctttggaggagca
gcagccaacgcaggaaacagtggaaataaggataacaaatcaatgtttgcatttggcgga
gctgacaacaactcggtagccaagccaagtgggctatttagctttggtggcacggacaag
ccggccccacctgcctttggcagcgtaacgacatcggtgacatctgccacagcgacgcca
acaaacagcgcctttggatttagcacagctcagaagcccgcaacacccatgtttggaagt
ggatcaacgcaacagtcttcgacaccttcggtggcagccgccaaaccttttacatttggt
ggtgggaccgcgcagccccctgcaccggcagcttctacagcttcaggtggattctcgttt
gccgccgttgcgtccaaaaataccacggagccaacagcaacaaatttgtttggcagcccc
gccaacgccagcaagccaagcttcaactttggaggaaacaccgccacccagacagcacca
ggagcagcaggatcaccagctggtggcttctcctttgccacggccaccaagaaggaggac
tctgctagcaccaatatgtttggaagccccaacaccggagtggtgaaacctaatttcagc
ttctccagcaacaattcaaccacacaatcggcagctcctactccagcacctacctttggc
ggattcggtgctccggcagctgctgcaccagcagctccctcaactaatcagaataagccc
tttgcattcggaggtagcactccggcttccgcccccagcgcagcgcccttgggcggcaac
ctctttgccaatgcagtgtccgctacccagaaccaaccgaagccaggagtcttctcattt
ggtggcgccaagagcacacccagcgccacagccggcaatgctcccttctcgtttggcggc
gcatctgctgggggcatcgcctcgccgcccagtaatcagggcttaaataccgcaaagcct
ttcagctttggtggcgccggaggcactccagccccgaatgtcttcggaagtccagcgcct
gtttcgcaagcaagcaatcctgcagggggcttcagcttcggcggcgccagtccagctcag
caggcgaatgctggaaacttatttgcccccacgccagagagtcggcccattcgtaaggcc
actaggcggctgcagaaatag

DBGET integrated database retrieval system