KEGG   Drosophila yakuba: Dyak_GE24231Help
Entry
Dyak_GE24231      CDS       T01068                                 

Gene name
dyak_GLEANR_7946
Definition
(RefSeq) GE24231 gene product from transcript GE24231-RA (EC:2.1.1.43)
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
dya  Drosophila yakuba
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dyak_GE24231 (dyak_GLEANR_7946)
Enzymes [BR:dya01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dyak_GE24231 (dyak_GLEANR_7946)
Chromosome [BR:dya03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dyak_GE24231 (dyak_GLEANR_7946)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 693 aa AA seqDB search
MIMVRRRQRPAKETTSSSSGGASSGSGIPVDQALPLNVAGNLLEDQYFASPKRKDCRLMK
VTQNGQLPEATMMAHNKDNKAGRTIGVPLATRSQTRTIENFFKANAAAKDFQKTIHTGEQ
LDLGDQELKLDDEELNGHIKLDDEVLKLADQQINENLPFADEVDAKAEQKLMDEELQQVV
EELLFDGSSRASSNSPCYQHDMVAMQEIQQIPEIPHIKKVAEPHEGLGSLADFQTHRSAL
RDSHSSTHSSSTDNIFLQEPVLTLDIDRTPTKASSIKINRSFELAGAVFSSPPSVLNACL
NGRFNQIVSLNGQKEPLDAPHFDLDQHDSSSCDSGVACGLTANTESPAGQPRRRKPATPH
RILCPSPIKTALKVTGGICKVGSTDPLSPRKSPRKLPATTAAVAACKSRRRLNQPKPQAP
YQQQPQLQKPPPQQHQQQQDDIVVVLDDDDDEEEDEDDVRALLKAAEERENQNKAPATAN
SNKAGMKAMLKPAPVKSKTKSKGPTKGQPPLPLAATNGNREMTDFFPVRRSVRKTKTAVK
EEWMRGLEQAVLEERCEGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISISEAAERE
KRYALDENAGCYMYYFKHKTQQYCIDATVDTGKLGRLINHSRAGNLMTKVVLIKQRPHLV
LLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgataatggtgcgaagacgacaacggcccgccaaggagaccacatcctcttcctctggt
ggagcctcctcgggatcgggaattcctgttgaccaagcactgccactaaatgtggcggga
aatctgctggaggatcagtattttgccagccccaagcggaaagactgccgtttgatgaag
gtcactcaaaatggccaactgccggaagccacaatgatggcacacaacaaagacaacaaa
gcgggtcgcacaataggcgttcccttggccacacgctcacaaactcgcaccattgagaac
tttttcaaagccaatgctgccgctaaggatttccaaaagacaatacacacaggagagcag
ctggatctaggagatcaggagctgaaactagacgacgaggagctaaatggacacattaaa
cttgatgacgaggtgctaaagctggcagaccagcagataaatgaaaaccttccctttgcc
gacgaagtagatgccaaggcagaacaaaaacttatggatgaggaactgcagcaggtggtg
gaggagctattattcgatggcagttccagagcctcctcaaattcgccctgctatcaacat
gacatggtggccatgcaggagattcaacagatcccagaaattccacacatcaaaaaggtc
gcagagccgcacgaaggactgggctctctggccgacttccagacacatcgttctgcgctg
agggacagccatagttccacgcacagcagcagcaccgacaacatcttcctgcaggaaccg
gtactgaccctggacattgatcgcacgcccactaaagcatccagcataaagatcaatcgg
agttttgaactggccggagccgtattctcatcacctccgtcggtgctaaacgcctgtctt
aatgggcgcttcaatcaaatagtaagcctgaatggacaaaaggagccgctggacgcgccg
cacttcgatttggatcaacatgacagtagttcctgcgacagcggcgtggcctgtggactc
accgccaatacagaatcgccagcggggcaaccacgacgcagaaaaccagccacaccgcat
cgcatactctgcccctcgccaatcaaaacggctttgaaggtaactggaggtatttgcaag
gtcggatctacggacccgttgtcgccacgcaaatcccctcgaaaactgccggccactaca
gcagcggtggccgcctgcaagtcgcgccgaagactgaaccagccaaagccacaagcgcct
taccagcaacagccacagctacagaaaccaccgccacaacagcatcagcagcagcaggat
gacatcgtcgtggtgctagacgacgacgatgatgaagaggaggacgaggacgacgttcga
gctctgctcaaggctgccgaggagcgcgaaaaccagaacaaagcaccagccacagcgaac
agcaataaagcaggcatgaaagccatgctcaagcctgcgccagtgaaatcaaagaccaaa
agcaaggggccaacgaagggacaaccgccactgcctttggctgccaccaacggcaaccgt
gagatgaccgacttcttccctgtgcgaaggagtgtgcgcaagactaagacggccgtcaag
gaggaatggatgcggggcttggagcaagcagtgctggaagagcgttgcgagggtctccaa
gtacgccacttcatgggcaagggaagaggagtggtcgccgatcggcccttcaaacgtaac
gagtttgtggtcgagtatgtgggagatctcatctctataagcgaagccgcggagcgggag
aaacgctatgcgctggacgagaatgctgggtgctatatgtactacttcaagcacaagacc
cagcagtactgcatcgatgcaaccgtggataccggcaagctggggcgccttatcaatcac
tcgcgggctggtaacctaatgaccaaagtagtacttatcaaacagcggcctcacctcgta
ctcctggccaaggacgacatcgagccgggcgaggagctgacctacgactacggggaccga
tccaaggagtcactattgcaccatccctggttggccttctga

DBGET integrated database retrieval system