KEGG   Drosophila yakuba: Dyak_GE24292Help
Entry
Dyak_GE24292      CDS       T01068                                 

Gene name
Dyak_Tm2
Definition
GE24292 gene product from transcript GE24292-RA
Organism
dya  Drosophila yakuba
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTA
KEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAE
HAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAELAGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataacgccatcgac
aaggccgacacctgcgagaaccaagccaaggatgccaactcccgcgccgacaaactgaac
gaggaggtgcgcgatctggagaagaagttcgtccaggtggagatcgatctggtcaccgcc
aaggagcagctggagaaggccaacaccgagctggaggagaaggagaagctcctgaccgcc
accgagtccgaggtggccacccagaaccgcaaggtgcaacagattgaggaggatctggag
aagtccgaggagcgctcgaccaccgcccaacagaagctgctggaggccacccagtcggcc
gatgagaacaaccgcatgtgcaaggtgctggagaaccgttcccagcaggatgaggagcgc
atggaccagctgaccaaccagctgaaggaagcccgcatgctggctgaggatgccgatacc
aagtccgacgaggtctcccgcaagctggccttcgttgaagacgagctggaggtggctgag
gatcgtgtccgctccggcgagtccaagatcatggagctggaggaggagctcaaggttgtc
ggtaactccctgaagtccctggaggtgtccgaggagaaggccaaccagcgcgtggaggag
ttcaagcgcgagatgaagaccctgtccatcaagttgaaggaggccgagcagcgcgccgag
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaggacgagttg
ggcatcaacaaggacaggtacaagtccctggccgacgagatggactccacattcgccgag
ttggctggctactaa

DBGET integrated database retrieval system