KEGG   Drosophila yakuba: Dyak_GE24304Help
Entry
Dyak_GE24304      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dya  Drosophila yakuba
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dyak_GE24304
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dyak_GE24304
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dyak_GE24304
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Dyak_GE24304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 385 aa AA seqDB search
MGPIQRLVYTFGQRTCSQLPIIGSAAISNTKPTTMALSVRQSSSSVLATESSNKGMIILN
RPKALNAINLEMVRKIYKHLKKCEKSKSLVIIKGTGEKAFCAGGDVRALVEAGPTDESKS
FFREEYSTNALIGNYKIPYIAIIDGITMGGGVGLSVHGKYRVASDRTLFAMPETAIGLFP
DVGGSYFLPRLQGKLGLYLGLTGYRLRGGDVFYSGIATHYCESSKIPDLETALLNCPDAD
DVPELLQKYHSTPEKPFSLQPVLEQINKNFSADSVEGILENLQNDGSEWAKKTLETLSKM
SPTSMKVTFRQLELGSQLSLAQCLIMEYRLAVRHLERSDFKEGVRALLIDKDQKPQWQPT
KLADVTEEHVQWFFRKLPDTEELKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaattcaaaggttggtgtacacattcggtcagcgcacctgtagccaattgccg
attatcggctcagcagcgatatccaacaccaaaccaacaacaatggccctctccgtccgc
caatcctcctcctccgtgctggccacggagtcctccaacaagggaatgattattctgaat
cgtcccaaggcgcttaacgccattaacttggagatggtacgtaagatctacaagcacctg
aagaagtgcgagaagtccaagtcgctggtgatcatcaagggcacaggtgaaaaggccttc
tgtgccggtggagatgtgcgtgctctggtcgaggcgggacccacggatgaatcaaagagc
tttttccgggaggagtacagcacgaatgccctgatcggaaactataagattccctatatc
gccatcatcgacggtattactatgggcggtggcgtgggtctgagtgtgcacggcaagtac
cgtgtggccagcgatcggacgctgttcgccatgcccgagacggcgattggcctcttcccg
gatgtgggtggatcatacttcctgcctcgactgcagggaaagttgggcctttacctgggt
ctcactggatatcgactgcgcggaggcgatgtcttttactcgggcattgccacacactat
tgcgagagcagcaagatccccgatctcgagacggcgctgcttaactgcccggatgcggat
gatgtgcctgagctgctgcagaagtaccattccacgccagaaaagcccttctcgctgcag
cctgtcctggagcagatcaacaagaacttttcggcggattcggtggaggggattctggag
aatcttcagaatgacggcagtgaatgggccaagaaaacgcttgagaccctctcgaagatg
tctcccacctcgatgaaggttacattccgtcagctagagctcggatcacagctatctttg
gctcagtgtcttattatggagtatcgtctggccgtgcgtcacttggagcgcagtgatttc
aaggaaggagttcgcgctctgctcatcgacaaggatcagaagccccagtggcagccaact
aagctggccgatgttacagaggagcatgtgcagtggttcttccgcaagctgccggatacc
gaggaactcaagctgtaa

DBGET integrated database retrieval system