KEGG   Drosophila yakuba: Dyak_GE24403Help
Entry
Dyak_GE24403      CDS       T01068                                 

Definition
GE24403 gene product from transcript GE24403-RA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dya  Drosophila yakuba
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dyak_GE24403
   00670 One carbon pool by folate
    Dyak_GE24403
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dyak_GE24403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 181 aa AA seqDB search
MLSFNLIVAVCENFGIGINGNLPWRIRSELKYFSRTTKRTSDPSKHNAVVMGRKTYFGVP
EGKRPLPDRLNIVLSTTLQENELPKGVLLCRNLEAAMKALEDKNEVENIWIVGGSGVYEE
AMASTRCHRLYITKIHEKFECDTFFPAIPDSFREVAPDSDTPLGLQEENGIKFEYKVLEK
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcttcaatttaatcgtggcagtttgcgagaatttcgggatcggcatcaatggc
aatctcccgtggcgcattagatccgagctgaagtactttagccgcaccaccaagcgaacc
agcgatcctagcaagcacaatgcagttgtgatgggcaggaaaacctatttcggagtgccg
gaaggcaagagacctcttcccgatcggctgaacatagtgctgagcaccacactccaggaa
aacgaattgcccaagggagtactgttgtgtcgcaatctcgaggcggccatgaaagcgctc
gaggacaagaacgaggtggagaacatttggattgtgggcggtagtggcgtctacgaggaa
gccatggcctcgacaagatgtcaccggctgtacattaccaaaatccacgagaagtttgaa
tgcgataccttctttcccgcgatcccggacagcttccgtgaggttgcgcccgattcggac
acgccactcggtctccaggaggagaatggcatcaaattcgagtacaaggtcttggagaaa
cagtga

DBGET integrated database retrieval system