KEGG   Drosophila yakuba: Dyak_GE24538Help
Entry
Dyak_GE24538      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dya  Drosophila yakuba
Pathway
dya00010  Glycolysis / Gluconeogenesis
dya00260  Glycine, serine and threonine metabolism
dya01100  Metabolic pathways
dya01200  Carbon metabolism
dya01230  Biosynthesis of amino acids
Module
dya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dya_M00002  Glycolysis, core module involving three-carbon compounds
dya_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE24538
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dyak_GE24538
Enzymes [BR:dya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dyak_GE24538
Membrane trafficking [BR:dya04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dyak_GE24538
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dyak_GE24538
  Exosomal proteins of melanoma cells
   Dyak_GE24538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 6536776
NCBI-ProteinID: XP_002097347
FlyBase: FBpp0269548 FBgn0241650
UniProt: B4PNP4
Position
3R
AA seq 292 aa AA seqDB search
MLALARNSWCGQLLSRLANIEALCPYSKSSAGGKQAEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQDTLRAALKSSEHKKIPVC
ISWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIAEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDESIKPLATLKFLGDPETVKKAMESVANQGKAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctggccaggaattcgtggtgtggccaattgctgagtcgcctggcaaacatc
gaagccctctgcccatactcaaagtcatccgccggcggaaagcaggccgagaagaagggc
aagtacaggatcgtgatggtgcggcatggggagtccgagtggaaccagaagaacctattc
tgcggatggttcgatgccaagctatcggagaaggggcagcaggaggcctgtgccgccggc
aaagccctcaaagatgccaaaattgagttcgatgtggcccacacttcggtgctgaccaga
gcccaggatacactcagggctgccctgaagtccagcgagcacaagaaaatcccagtgtgc
atctcgtggcggctcaacgagcgccactacggcggactgacgggtctgaacaaggccgag
accgccaagaagttcggcgaggagaaagtaaagatctggcgccgcagctttgacacccca
ccgccgcccatggagaaggatcacgagtactacgcctgcatcgcagaggatccgcgctac
aaggaccaactgaagccggaggagttccccaaatccgagtccctcaagctcaccatcgag
cgcacattgccctactggaacgaggtcatagtgccccaaatcaaggatggaatgcgtgtc
ctgattgccgcccacggcaacagcctgcgaggcgtggtcaagcacttggaatgcatctct
gacaaggacatcatgagcctcaatctgcccacgggcattcccttcgtctacgaactggac
gagagtatcaagcccttggccaccttgaagttcctcggcgacccggagacggtcaagaag
gcaatggagtcggtggctaaccagggcaaagccaagtga

DBGET integrated database retrieval system