KEGG   Drosophila yakuba: Dyak_GE24538Help
Entry
Dyak_GE24538      CDS       T01068                                 

Definition
GE24538 gene product from transcript GE24538-RA
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dya  Drosophila yakuba
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dyak_GE24538
   01230 Biosynthesis of amino acids
    Dyak_GE24538
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dyak_GE24538
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dyak_GE24538
Enzymes [BR:dya01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dyak_GE24538
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dyak_GE24538
  Exosomal proteins of melanoma cells
   Dyak_GE24538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 292 aa AA seqDB search
MLALARNSWCGQLLSRLANIEALCPYSKSSAGGKQAEKKGKYRIVMVRHGESEWNQKNLF
CGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQDTLRAALKSSEHKKIPVC
ISWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIAEDPRY
KDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECIS
DKDIMSLNLPTGIPFVYELDESIKPLATLKFLGDPETVKKAMESVANQGKAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttggctctggccaggaattcgtggtgtggccaattgctgagtcgcctggcaaacatc
gaagccctctgcccatactcaaagtcatccgccggcggaaagcaggccgagaagaagggc
aagtacaggatcgtgatggtgcggcatggggagtccgagtggaaccagaagaacctattc
tgcggatggttcgatgccaagctatcggagaaggggcagcaggaggcctgtgccgccggc
aaagccctcaaagatgccaaaattgagttcgatgtggcccacacttcggtgctgaccaga
gcccaggatacactcagggctgccctgaagtccagcgagcacaagaaaatcccagtgtgc
atctcgtggcggctcaacgagcgccactacggcggactgacgggtctgaacaaggccgag
accgccaagaagttcggcgaggagaaagtaaagatctggcgccgcagctttgacacccca
ccgccgcccatggagaaggatcacgagtactacgcctgcatcgcagaggatccgcgctac
aaggaccaactgaagccggaggagttccccaaatccgagtccctcaagctcaccatcgag
cgcacattgccctactggaacgaggtcatagtgccccaaatcaaggatggaatgcgtgtc
ctgattgccgcccacggcaacagcctgcgaggcgtggtcaagcacttggaatgcatctct
gacaaggacatcatgagcctcaatctgcccacgggcattcccttcgtctacgaactggac
gagagtatcaagcccttggccaccttgaagttcctcggcgacccggagacggtcaagaag
gcaatggagtcggtggctaaccagggcaaagccaagtga

DBGET integrated database retrieval system