KEGG   Drosophila yakuba: Dyak_GE24648Help
Entry
Dyak_GE24648      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE24648
   00053 Ascorbate and aldarate metabolism
    Dyak_GE24648
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE24648
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE24648
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE24648
   00982 Drug metabolism - cytochrome P450
    Dyak_GE24648
   00983 Drug metabolism - other enzymes
    Dyak_GE24648
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE24648
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE24648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 519 aa AA seqDB search
MRIFTLILGLLCSLGYSSGYNYLMVLNSAGRSHFNVGHALAKGLVKAGHDITVVSVYPLK
KPIPGYTDVNVPNIFNVMGGDIAALWSSIQKPVTQKLIDHYQMGFRITRGLFEDPNFQDF
LKSNQSFDAIICETFYNDAHYGLAEHFNAPLIGLSTGGGVTFITDMVGSPAPASFVPHIM
LPFNDHMSLYERLLNVAFLGYERLLLDYYYLPNQEKLYKEFFPGNKRCFYEMRRNASLVL
INQHVSLSFPRPYTPNMIEVGGMHIDGKLSPLPEKIERFINESEHGAIYFSMGSNLKSKD
LPPAKVQEILRALGGLKQRVLWKFELDNLPNKPENVYISDWFPQTDILAHPKVLAFVTHG
GMLSTTESIYHGKPVVGLPIFSDQFFNMAHAVQTGYGIMLDFKTLNAADFQKAIERITSE
LSYTKVVQGMSLRYRDQQQTPLENAVYWVEHVTRHQGAAYLQSAAQRLNWWQYHNVDVLL
IIFGVAFLLVIALPFTIFKLLKNKLSIGERTKSTKVKRN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatattcaccttgatcttggggctactttgtagcttgggatactcgagtggatac
aactatctgatggttctgaattccgccggtcgttcccactttaatgtgggtcacgccttg
gccaagggattggtcaaagctggccatgacatcaccgtggtatccgtgtatcctctgaag
aaacccattccgggctatactgatgtgaatgtgccaaatatattcaatgtcatgggggga
gacattgcggccttgtggtcatcgatccaaaaaccagtgactcagaaactcatcgaccac
tatcaaatgggattccgcatcacaagaggtcttttcgaggaccccaatttccaggatttt
ctgaagagcaaccaaagcttcgatgcgatcatatgtgagaccttttacaatgatgctcat
tacggtttggcggagcattttaatgccccacttattggattgagcactggtggcggtgtg
acatttatcactgatatggttggttctcccgctccggcttcgtttgtgccccacataatg
ctacccttcaacgatcacatgtcactgtacgaacgccttttgaacgtggccttccttggc
tatgaaaggctactgctagactattattacttacccaatcaggagaagttatacaaggag
ttttttccgggaaacaaaaggtgtttctatgagatgcgccgcaatgcctccttggtgctc
atcaatcaacatgtttcactaagctttccgagaccgtacacacccaacatgattgaagtg
ggcggcatgcatatcgacggcaagttgagtccactgcccgagaagattgagagattcatc
aatgagtcagaacatggagccatctacttttccatgggatcgaatctcaagagtaaggac
ttacccccagcaaaggtgcaagagatcctgagagcattaggtggactcaaacagcgagtt
ctgtggaaatttgagctggacaacctgcccaataagccggagaatgtctacatctccgac
tggtttccacagacggacatattggcccatcccaaggtcctggcatttgtgacccacggt
ggtatgctcagcaccacggagtctatttatcatggcaagcccgttgtgggattgccaatc
ttcagtgatcagttttttaacatggctcatgccgtgcaaactggatatggcatcatgctg
gacttcaagacgctgaatgccgctgatttccagaaggccatcgagaggattaccagtgag
ctctcgtacacgaaagtggtgcagggcatgtccttgcgatatcgggatcaacagcagacg
ccactggaaaatgcggtatactgggtggaacatgtgacccgccatcaaggagctgcctat
ttgcagagtgcggcccaaagactgaactggtggcagtatcacaatgtggatgtgcttctg
atcattttcggggtagctttcctattggtaattgcactaccctttaccatctttaagcta
ctcaaaaacaaattatctataggagagagaactaaaagcactaaggttaaacgcaactag

DBGET integrated database retrieval system