KEGG   Drosophila yakuba: Dyak_GE24693Help
Entry
Dyak_GE24693      CDS       T01068                                 

Definition
GE24693 gene product from transcript GE24693-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dyak_GE24693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 325 aa AA seqDB search
MSCNYADGLSAYDNKGILGAPESFDSDEIVAEKCQELVDLIKKSGHVVLHTGAGISTSAG
IPDFRGPKGVWTLEEKGEKPDFNVSFDEARPTKTHMAIIALIESGYVQYVISQNIDGLHL
KSGLDRKYLSELHGNIYIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMNSKGRSCRSG
ILYDNVLDWEHDLPENDLEMGLMHSTIADLNIALGTTLQIVPSGDLPLKNLKRGGKFVIC
NLQPTKHDKKANLIVSSYVDVVLSKVCKLLGVEIPEYSEASDPTKHSKPLEWTIPTSNVN
TFHREYRKYVKDSKIESIAKKTKYK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcaactacgcggatggattgtcagcctacgacaacaagggaatcctgggagca
ccagagagtttcgacagcgatgagattgtggccgaaaagtgccaggagctggttgatttg
atcaagaaatccggacacgttgtcctccacacgggggctgggatcagcacgtccgcaggg
attccggatttccgcggacccaagggcgtttggacgctggaggagaagggcgagaagccg
gacttcaatgtctccttcgatgaagccagacccactaaaacccacatggccatcatagct
ctgattgaaagtggctatgtgcagtacgtaatctcgcagaatattgatgggctccacttg
aaatccggactggatcggaaatatctttccgagctgcacggcaacatttacatcgaacag
tgtaagaagtgcagacgccaatttgtgagcccatctgccgtggaaacagtgggtcaaaag
agcttgcagcgtgcctgcaaatcctcaatgaacagcaaaggtcgtagctgcagatcggga
atcctatacgataacgttctggactgggaacatgatctgcccgaaaacgacctcgaaatg
ggattgatgcactccaccatcgctgacctaaatattgcgcttggaaccactttgcagatc
gtgcccagcggagatttgcctttaaaaaatctgaaacgcggtggaaaatttgtcatttgt
aatctgcagcccacgaaacatgacaaaaaggctaacctaatcgtatccagctatgtggat
gtggttttgtccaaggtttgtaaactattgggtgttgagatacccgaatattcggaggca
tccgatcctaccaagcactcaaagccattggagtggaccatacccacaagcaatgtaaat
acctttcacagagagtatagaaaatatgtaaaagattccaagattgaatccatagctaag
aaaaccaagtacaagtaa

DBGET integrated database retrieval system