KEGG   Drosophila yakuba: Dyak_GE24839Help
Entry
Dyak_GE24839      CDS       T01068                                 

Definition
GE24839 gene product from transcript GE24839-RA
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dya  Drosophila yakuba
Module
MAPK (JNK) signaling
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dyak_GE24839
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dyak_GE24839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 424 aa AA seqDB search
MAERPKNLFATGSSRSRNPPDQLSLNNLSIRHPPSSTSSTSSGSTSSGSSSSSQHNHVTR
CFGAQQPQQTPPVASSHVPPVPAASSSSAADRHRERIRQQACGKLQFGDGAANTHTFTSD
DLEDEGEIGRGAFGAVNKMIFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIY
IVQFYGALFKEGDCWICMELMDTSLDKFYKYIYEKQQRHIPESILAKITVATVNALNYLK
EELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA
KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEF
VDFVNTCLIKKESDRPKYSRLLEMPFIRRGETSHTDVAVYVADILESMEKDGITQFTANQ
PAES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgaccgaaaaatttgtttgcaaccggatccagtcgctcccgcaatcctccg
gatcagctaagcctgaacaaccttagcatacgccatccgccctcgtctacgtcgtcaaca
tcttcgggatccacatcctcgggctcaagttcctcatcacagcacaaccatgtgacccgc
tgttttggcgcccagcagccacagcagaccccgccggtggccagcagtcatgtgccaccg
gtaccggcagcatcgagcagcagcgctgccgatcgtcaccgggagcgtattcggcaacag
gcctgtggcaagctacagtttggtgacggtgccgccaatacacacacatttacttcagac
gatctcgaggatgagggcgaaattggacgcggtgcatttggggcagtcaacaagatgatc
ttcaagaaactggacaaggtaatggccgtgaaacgcattcgatccaccgtagacgaaaag
gaacagaagcaactgctcatggatctcgaggtggtcatgaagtccaacgagtgcatctac
attgttcagttctacggcgcactgttcaaggagggtgactgctggatttgtatggagctg
atggacacctcgttggacaagttctacaagtacatttacgaaaaacagcagcgccacatt
ccagagtccatactggctaagataacagtggccacggtcaatgcactgaactatttgaag
gaggagcttaagattatccatcgggatgtgaagccgagtaatattctattgcatcgtcgc
ggagacataaagctgtgtgattttggtatttccggtcagctggttgactctattgccaag
accaaggatgcgggatgcaggccctatatggcgccggagcgcattgatccagagcgtgcc
aagggctacgatgtacgaagcgatgtttggtcattgggcataactttgatggaggtggcg
accggtaatttcccctatcgcaaatgggactctgttttcgagcagttgtgtcaggttgtg
caaggcgaaccgccgcgacttttgacatcctataacggcatggagttctccaaagagttt
gtggactttgtcaatacttgcctaattaaaaaggagagcgatcgaccgaagtatagccgg
ctgctggagatgcccttcattcgacgtggtgaaacgagccacactgatgttgccgtctat
gtggccgatattctggagtcaatggagaaagatggcataacacagttcacggccaaccag
ccggcggagagttaa

DBGET integrated database retrieval system