KEGG   Drosophila yakuba: Dyak_GE25053Help
Entry
Dyak_GE25053      CDS       T01068                                 

Definition
GE25053 gene product from transcript GE25053-RA
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dya  Drosophila yakuba
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dyak_GE25053
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    Dyak_GE25053
   04068 FoxO signaling pathway
    Dyak_GE25053
   04070 Phosphatidylinositol signaling system
    Dyak_GE25053
   04150 mTOR signaling pathway
    Dyak_GE25053
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dyak_GE25053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1088 aa AA seqDB search
MNMMDNRSLAYVAHQPKYEPPPEEAEPPCMRFSVNLWKNEMLDWVDLICLLPNGFLLELR
VNPAITIQVIKVEMVNQAKQMPLSYVIKEACEYQVYGISTFNIEPYTDETKRLSEVQPYF
GLLSLGERTDTTSFSSDYELTKMVSGMIGTTFDHNRTHGSPEIDDFRLYMTQTCDNIELE
RSVYTWQQRLLYEHPLRLANSTKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDTP
FSLTESTLQKMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLIQFLYIQETLSDSAVPNV
VLQSVYRLESYINHHNEQAMAPKRPPPKKQPTLLPKALSSLWDMGNYFQLTLHSISNVNY
DKTRALKVGVHVCLYHGDQKLCAQRSTDSPNGNYDTFLFNDLVMDFDIQMRNLPRMTRLC
IVIFEVTKMSRSKKSSNHKDSTLKDVSYNKNPLAWVNTTIFDHKDFLRTGRHTLYTWTYA
DDIQSDEVFHPLGTIEPNPRKEECALVDLTFHSSGTGTVRYPSEEVVLQYAADRAQASRL
QTQLAGPEKPIKELKDLVANYTGLDKIYEMVDQDRNAIWERRNDIMRELPEELSILLHCV
YWKERDDVADIWYLLKQWPLISIERSLELLDYAYPDPSVRRFAIRCLHFLKDEDLLLYLL
QLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLK
GCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSGVFQNIQNPLNP
SFRCSGVTPDRCKVMDSKMRPLWVVFENADLNSSDVHIIFKNGDDLRQDMLTLQMLRVMD
QLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSW
LKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILG
HFKEKLGVRRERVPFVLTHDFVYVINKGFNDRESKEFCHFQELCERAFLVLRKHGCLILS
LFSMMISTGLPELSSEKDLNYLRETLVLDYTEEKARDHFRAKFSEALANSWKTSLNWASH
NFSKNNKQ
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatggacaaccggtcgttggcctacgtggcccaccagcccaagtatgagcca
ccgccggaagaggcggagccgccctgcatgcgcttttcggttaacctgtggaagaacgag
atgctggactgggtggacctgatctgcctgttgcctaatggattcttgctggagctcagg
gtcaatccggccatcaccatccaggtaatcaaggtggagatggtcaaccaggccaaacag
atgccactgagctatgtgatcaaagaggcctgtgagtaccaggtgtacggcatctcgacc
tttaacatcgagccgtacaccgacgaaacgaagcgactcagcgaggtgcagccgtacttc
ggactgctcagcctgggcgagcgcaccgacacaacgagctttagcagcgactacgagctg
accaagatggtcagcggaatgatcggtaccactttcgaccacaatcggacgcacggttcg
cccgagattgacgactttcgactgtacatgacccaaacttgcgacaacatcgagctggag
cgctccgtctacacctggcagcagagactgctttacgaacatccgctacggttggccaac
tcgacaaagatgcccgagctgatacgagagcggcatcccaccaggacctttctcattgtc
gttaaaaacgagaacgaccagagcacgttcacgttgtcggtgaacgagcaggacaccccc
ttctcgctgacggagagcacgctgcagaagatgaaccgatcgcagatgaaaatgaacgac
cggacctccgactacatactcaaggtgagcggtcgcgacgagtaccttctcggcgactat
ccgctgatccagttcctgtacatccaagagacgctctcggactcggcagttccaaatgtg
gtgctgcaatcagtgtatcgccttgagtcctacatcaaccaccacaacgagcaggccatg
gcgcccaagcgaccgccgccgaagaaacagccaactctcctccccaaggcgctctcttcg
ctgtgggacatgggcaactattttcagctgacgctgcatagcatctccaatgtgaactat
gataagacgcgcgccctaaaggtgggcgtgcatgtgtgcctatatcacggcgatcaaaag
ttgtgcgcccagcgatcaacggactcccctaacggcaactatgacacgtttctgtttaat
gacctggtgatggactttgacatacagatgcgcaatttaccgcgaatgacacgcctctgc
attgtgatcttcgaggtgaccaagatgtcgcgctcgaagaagtcctccaaccataaggac
agcactctgaaagacgtctcctacaacaaaaacccgctagcctgggtcaacacaacaatt
tttgaccacaaggacttcctgcgcactggtcgccatacgctgtacacgtggacgtatgct
gacgacattcagtctgacgaggtgttccatccgctgggcaccatcgaacccaatccgcgc
aaagaggaatgtgcgctagtggacctcacattccacagtagcggaaccggaaccgtgcga
tatcccagcgaggaagttgtgctgcagtacgctgcggatcgggcgcaggctagtcgactg
caaacgcaactggcaggaccagaaaagccgatcaaagaactgaaggatctggtggcgaac
tatacggggttggataagatctacgagatggttgaccaggaccgcaatgccatttgggaa
cgcagaaacgacattatgcgcgagcttccagaagaactgtccatcttacttcactgcgtc
tactggaaggagcgtgacgacgtagcggacatatggtatctcttgaaacagtggccgctt
atttctatagaacgctccttggagctgctagactacgcctatccagatccgtcagtgaga
cgctttgccattcgatgcttacactttctgaaagacgaagacttgctcctgtatctgctt
caattggtacaggccatcaagcacgaatcgtacctggaaagcgatctggtagtgtttctg
ctggagcgggcactgcgcaaccagcgcatcggccactacttcttctggcacttgcgctct
gagatgcagacgccgtctatgcaaacgcgctttggcctgctgctggaggtctacctcaag
ggttgcaaacatcacgtggcgccgctgcggaagcagctacatgtgctagagaaactaaaa
cagggatctctgattgccaagaaaggcagcaaggaaaaagtgaagaccatgctgcaggac
ttcctgcgtgaccagcgcaactcgggggtctttcagaacatccaaaatccacttaatccc
agctttcgttgcagcggtgtaactccagataggtgcaaggtaatggatagcaagatgcgc
ccgctatgggtggtattcgagaatgccgacttgaactccagcgatgtgcacatcattttc
aagaatggcgacgatctccgccaagacatgctcacgttgcagatgctgcgtgtgatggac
cagctgtggaaacgcgatggtatggacttccgcatgaacatatacaactgcatcagcatg
gaaaaaagcctcggcatgatagaggtggtacgccacgcagaaaccattgccaacatacag
aaggagaagggtatgttctcggccacgtcgccattcaagaagggctcgctcctcagttgg
cttaaggagcataacaagcccgccgacaaactgaacaaagccatcaatgagttcacgctc
agttgtgcgggctactgcgtggccacctatgtgcttggcgtagctgatcggcactcagac
aatataatggtcaaaagaaatggacagctatttcacatcgatttcggccacatcctgggc
cacttcaaggaaaaacttggagtacgtcgtgaacgagttccctttgtgttgacccacgat
ttcgtctacgtgatcaacaagggttttaatgacagggagtctaaagagttttgtcacttt
caggaattgtgcgagcgcgcctttttagttttacgtaaacacggctgccttattttatca
ctgttctcaatgatgatttcaacgggactgccagaactgtcctccgaaaaggatttgaac
tacctacgggaaactttagtgctggactacacggaagaaaaagcacgcgatcatttcaga
gcgaaattcagcgaggctttggctaactcctggaagacttcccttaactgggcctcgcac
aatttctccaaaaacaataaacagtaa

DBGET integrated database retrieval system