KEGG   Drosophila yakuba: Dyak_GE25277Help
Entry
Dyak_GE25277      CDS       T01068                                 

Definition
GE25277 gene product from transcript GE25277-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 438 aa AA seqDB search
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRNSREEASDPDVRMSVADEDKMVDTK
NEFYDGDQDQDKADSAES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccggagggtttcatacttctacaacgcggacgtgggcaacttccactatgga
gcggggcatccaatgaagccgcagcgcctggcggtcactcacagcctagtgatgaactac
ggactgcacaagaaaatgaagatctacaggccgtacaaagccagtgcgcaggacatgctc
cgcttccacagcgacgagtacatcgcctacctacagcaagtgactccacaaaacatccag
tgcaattcggtggcctacaccaagtacctggcgcacttcagcgtaggcgaggactgtccc
gtgttcgatggccttttcgacttctgtgcaatgtacacaggtgcctcgctggagggagcc
caaaagctaaaccacaaccacagcgacatatgcataaactggtcaggtggactgcatcac
gccaagaagttcgaggcaagcgggttctgctacgtaaatgacattgtcatcggcattctg
gagctgctgaagtaccatccccgggtgctttacatcgacatcgatgttcatcatggcgac
ggggtgcaggaggccttctaccttacggaccgagtaatgacagcctcgtttcacaaatat
ggaaactactttttccctggcacgggagacatgtacgaaataggcgccgaatcgggacga
tactacagcgtgaatgtcccgctaaaggagggcattgatgaccagagctatttccaggtg
tttaaaccaatcatatcggccattatggacttctaccggcccactgccatcgttttgcag
tgtggcgcggattctttagcaggagatcgactgggttgcttctccttgagcaccaaggga
catggagagtgtgtcaagtttgtgaaagaactaaacgtacccacattggtggttggaggc
ggtggctacacattacggaacgtagcccgctgctggacgcacgagacctcactgctggtg
gaccaagacattgaaaatgatctgcctgccacagagtattacgacttcttcgcccccgac
tttacactccatccagagattaactcacgccaagataatgcaaactcaaagcagtatctg
gaactaatcgtaaagcatgtatatgaaaaccttaagatgtgccagcactcgcccagcgtc
caaatggtgcagaccccgcctgatgtggacttggaggagctgcgcaatagcagggaagag
gcgagtgatcccgacgttcgaatgtccgtggccgatgaagacaagatggttgacaccaag
aacgagttctacgacggcgatcaagaccaggacaaggccgattcggcagagagttag

DBGET integrated database retrieval system