KEGG   Drosophila yakuba: Dyak_GE25337Help
Entry
Dyak_GE25337      CDS       T01068                                 

Gene name
Dyak_tacc
Definition
GE25337 gene product from transcript GE25337-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dya  Drosophila yakuba
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dyak_GE25337 (Dyak_tacc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1312 aa AA seqDB search
MEFDGAENGLGMEFGGRGVLREINKNDGGIKMDFLASIIKRPKSIATTGITTNQPMTMEA
LKADGPADNYSTPRDKEGLSLVSQDLDTLVQSASESPQLKEPHCNLIKEPISNPLPAPED
ISCSRETIQTFLSEINFNLNQVSDNEMEHLQAMSGELSPLAVKPSPKPTSMEQQKAMAAA
LGHQAAVAGSLQLDAVKVPKFGGLPEFDEMQIPELAPLSTDIDTQLKCNHSDSDVFVECL
SLHSERYTGDRSELEAYSSALNDVLEQQLSMTSASTLEADFKDPLAVSQHNNVSYEAMDV
DDINETMEMLKDVLDPEDHQLMQTHILSVSQPKTETISVQYNQNQEQKRIEQDQLAKYPE
SNSDATKPSLLESVFPDQPVTPLLEPNLNLTALDYTKELAKHRDENQKDTKDEPQKEDHQ
PICSAQMENANSEEPLNLNEATEPSTYPAKTPKCLNQDMPFAVAVESMEKTFTPISHEQN
ASPAMEATEDRTVTELEHMEVDDFMRVSEAIVLTSSRQEQVNAHSPVSRKSCLNLCGKND
MDFQDNKMDHKTAGLESQLKMTEIELPAAQISTPIPTLQTRSKELPFSPPIPTHRPKAAE
ELEFRTLRELPLPDDVPSGGKVGVKQISHGRAPFVAVTPTQLRSTTHNSLDLDGKTTSAI
SPEPTSPSFPIRGPAETQSHFPRSPRAPLEQKDMPYLEEAVVEPSSDRNQSVFGAGVIEK
SAIVFQLTQPSPQKQNLNETLPMSEMSPTSSNMAFDSENISENKPQNDTDTFAVSVGSVD
NKQRRTFSASPAVGATEDTGADDVMDVDVSMRAYDVAVLKSPQQTWKEPQAPISNSPPIP
SHQHLKRPPIHETNSPVSPLRNGTVALEEQALSAKEQATLSASDEKDDVFLEHFGAISPV
SDDMFKTISGSNNQEKIRVNANREIEGKPAPALSKQRGGAPGELEAIIDAEFHDGASNQN
LILKSSDFDYLYTKGSNNAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQYQ
NRVLSPTLEEHETSDGNQSFGLISSCKDISVKWDCKPPVDTSKKHVKMSVDVIDNDCNKT
FDNFNANTEDKTHNYNNMDELEKKIKNEVTRSEDIEKKLKEGEQREEALIKRITEKDKTN
AKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLTSLETTFSDLHVKY
EKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREH
ADETKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgacggcgcagagaacggcctgggaatggaatttggcggtcgcggcgttctg
cgggagatcaacaaaaacgatggcggcattaagatggacttcctcgcaagtatcatcaaa
aggccaaaaagcatcgctaccactggcatcaccaccaaccaaccaatgacaatggaagcc
ttaaaagctgatggtcccgctgataattactctacaccaagggataaagaaggactttca
cttgtatcccaggacctggacacgttagtacagtccgcctctgagagtccgcaactgaag
gaaccgcactgtaatctaattaaggaacctatctcgaacccactcccagcccccgaggac
atcagttgtagtagagaaacaatacagacatttttaagcgaaataaacttcaatctgaac
caagttagtgataacgaaatggagcacttgcaagccatgagcggcgagctgagtccactg
gcggtgaagcccagtcccaagccgacgagcatggagcaacagaaggcaatggctgcagct
ctgggacatcaggcggcagtagccggtagccttcagctagacgcagttaaggttccaaaa
tttggaggtcttcccgagttcgatgaaatgcaaataccggaactggctcctttaagtacc
gatatagacactcaattgaaatgcaaccattcggattctgatgtttttgtcgagtgttta
tcgcttcatagcgagcgctatacaggagatcgatcggagctagaggcctattcaagtgcc
cttaatgatgttttggagcagcagctgtctatgacctcagcttctacactggaagctgat
tttaaagatcctttggcggttagccagcacaacaacgtcagctatgaagccatggatgtg
gatgacataaacgaaactatggaaatgttaaaggacgttttggacccggaagaccatcag
cttatgcaaacgcatattctcagcgtatcgcagcctaaaacggagactatttcggtgcag
tataatcaaaatcaggagcaaaagagaatagaacaagaccagttagctaaatacccggaa
tcgaatagtgatgcaacgaagccatcattattagaatcagtattccctgatcagcctgtt
acaccattacttgaaccgaatcttaacttaactgccttagactacacgaaagagctagct
aagcatcgtgatgaaaaccaaaaggatacaaaagatgaacctcagaaagaggaccaccaa
ccgatttgtagtgcgcagatggagaacgcaaattctgaggagcccttaaatctcaatgag
gctacagaaccctccacatatccagcaaaaactccaaaatgtcttaatcaagatatgcca
tttgcagtggcagtagaatcaatggaaaaaacattcactcccatcagccatgagcaaaat
gcgtccccagctatggaggcaactgaagacaggactgtgacggagcttgagcacatggaa
gtggatgactttatgagagtgagtgaggctatagtgcttacctcatctcggcaggagcag
gttaatgctcattcacccgtttcaagaaaatcttgtttaaacctctgcgggaaaaatgat
atggactttcaagataataaaatggatcataaaactgcaggcctggaaagtcaattgaag
atgactgaaatagagctaccagcagcacagatatcgacgcccataccgacacttcaaacc
agaagcaaggaactgcccttttctccgcccatacctacacatcgcccaaaggcagcggaa
gaactagagttccggactctgagggagttgcccttgcctgatgatgttccgtcgggaggg
aaggtgggagtaaagcagatttcacacggccgcgcgccctttgtggcagtcacaccaacg
cagctgcgatccacgacacataattctttggatctagatggaaaaacaacctctgcaatc
tctccagaacccacttcgcctagtttccctatcagaggacccgctgaaacacaatcccat
tttccacgctcaccccgtgctccgctcgagcaaaaagacatgccctatttggaagaagct
gtggtagaaccttcttcagatcgcaaccaaagcgtcttcggagctggtgtcatcgaaaag
tccgcaattgtctttcagttgacacaaccgagtccacagaagcagaacctcaacgaaacc
ttacccatgagtgagatgtctcccacttcctcaaatatggcatttgacagcgaaaacatt
tcggagaacaagccacaaaacgatacagacacattcgccgtaagtgtgggatcggtcgat
aataaacagcgccgtactttctcggcttctccagcagtgggggccaccgaagataccggg
gctgatgacgttatggatgtagatgtctccatgagggcatatgatgtagccgtattgaag
tcgcctcagcaaacttggaaggaacctcaagcaccaatttcaaattcaccgcctattcct
tcccaccaacatttaaagagaccccctatccatgagacgaattccccggtgtcacccttg
cgtaatggtaccgttgcgttggaggagcaggctctttccgccaaagagcaagccacgcta
agcgccagtgatgagaaggacgatgttttcttagaacactttggcgccatttcgccagtt
tcggatgacatgttcaagaccataagtggttccaacaatcaagaaaagattagggtcaat
gctaatagggaaatcgaaggaaaacccgctcctgcgttgagcaaacagaggggtggtgca
cctggcgagctggaggcgatcattgatgccgaattccacgacggcgccagcaaccaaaac
ctaatactgaaatcatcagattttgattatttgtacacgaaaggcagcaataatgcgcct
atcgaccgcagttcgctgctgctgaagtttgatcccctccttggagcccctgttcccgtt
aatcatccgaatcagcaggagcaggcgctgcagaatattcttggttcgaaccagtatcaa
aaccgtgttctgagcccaacattggaggagcacgaaacaagtgacgggaaccagtctttt
ggattaatatcgagttgcaaagatatatcagtgaaatgggattgtaagccacctgtggat
acgtcaaaaaagcatgttaaaatgagtgtagacgtcattgataacgattgcaacaaaacc
ttcgataatttcaacgctaatacggaggacaaaacgcacaactacaacaacatggatgaa
ctggagaagaaaatcaaaaatgaagtaacgaggtccgaagacattgaaaagaagctcaaa
gagggagagcagcgcgaggaagcactgatcaagcgtattacagaaaaggacaaaacaaat
gcaaaactaaacggtgtcatcgaggcatatgagaaggcaattgcggagctcattagtgag
aaggagcagcaggcgcagctccacgagcggcagttgcaagaagtccaggctgaccgggac
gccaattaccatcacttaacgtcactggagacgacattttccgatctgcatgtaaaatat
gaaaaaagcaaagagatgacctcgcagcttaaaagcaacgaagaatcgcttctggcggag
cggaagcagatgatggacaatctgcggttgcaggaacagcgctacgacaagatgaaaaac
catgccatgcagcagctggaaattgcaaacaaaaagctggacacctacgcgagggagcat
gccgacgaaacgaaaaaacttaaagctttacttaagaaggaggagatttctcgggtttcg
atgacggagcagctgcaacaaaaatcacgcgaaaacgccgatctgctcaagatctgcgaa
gagcttatctatggcaagggacaaggtggtagtagttaa

DBGET integrated database retrieval system