KEGG   Drosophila yakuba: Dyak_GE25491Help
Entry
Dyak_GE25491      CDS       T01068                                 

Definition
GE25491 gene product from transcript GE25491-RA
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dyak_GE25491
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: Other group
  TTK family
   Dyak_GE25491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 632 aa AA seqDB search
MTTPVPRRTKDMMALGLDSDSEDDFNTPYRPRPATAGERKQQPVASFQVQARGKENEPHP
LPTNMLPRRVSELTMMDLDSDEEDIKSNHNLNCAILNDSFVLSPSQELTNSNSNITTRKS
SNAAPFQQSDSNLSFLGQFNNMGINCSSQGSPDTNSEKLLAKKTAPTLQAVSNATERRPL
QETETPLRNEIASSSKTKSDADFITPQVRTIGSTHAGKSRSAVSNDFRAQKVLFQTPMTV
SRAAPVASASISFSLCDTITESPDIPEPPKKADPPMSQHPSKKSLDNVFRESEKDKVPAK
VDIVESKQLVSIPAVTVPPDPPSNSSKTSNILKIKNLEYTIDKKLGCGGSSSVYLARRSD
SGDEFALKVVDLQADPQVVQGYLNETKLLAKLQGNVCVVALYDYQLVREESKLYMVMEKG
DCDLNKILQSYTTNLPLYSLMNILYQMLQAVNYIHQNGVIHSDLKPANFLMVSGRLKLID
FGIASNISLDSTSIIKFSQAGTFNYISPEALTDTSTGNSPVRGANQPKIKISTKSDVWSL
GCILYLLLYQKTPFGHIRNIYAKMSAIATPATSIEYPAIPPYYPIMLVHMAKNCLQLNPK
KRPSCTELLQYPFHMIIPLQNLQIPSRTATSN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcctgtgcctcgccgcaccaaggacatgatggcattgggactggattccgac
tcggaggacgacttcaacacgccataccgaccacggccagcgacggcgggagaacgaaaa
cagcagccggtggcgtctttccaagtccaagctaggggcaaggagaatgagccgcatccc
ctgcctacaaacatgctacctcgtcgagtatccgagttgactatgatggatttggacagt
gacgaggaggacattaagagcaatcacaaccttaactgcgccatcctaaacgattctttt
gtactgagcccatcccaagagttaacaaacagcaacagtaacataaccactcgcaaatca
tccaatgccgcccccttccagcaatccgactcgaatctctcgttcctgggacaattcaac
aacatgggcattaattgcagcagccaaggatcacctgatacgaattcggaaaaactgttg
gctaaaaagacagcaccaacgcttcaagctgtgtcaaatgccaccgaaagacgcccactc
caagagacagagacgccactgcgcaatgaaatagcttcctcctcgaagacgaagtcggat
gcagacttcatcaccccccaagtgcgaaccattggttccacacatgctggaaaaagtcgg
agtgcggtgtccaacgacttccgtgcgcaaaaagtcctcttccaaacacccatgaccgta
agtcgtgctgctccagtggcctccgctagcataagcttctccctgtgcgacaccatcacg
gaaagtcccgacatcccagagcctccgaaaaaggctgacccacctatgagtcagcacccc
tccaagaagtccctagataacgtgttccgggagtcggaaaaagacaaagtgccagccaaa
gttgatattgtggaatcaaagcaattggtgtcaattcccgcagttaccgtccctccagat
ccgccttccaactcctccaagacttcaaatattttaaaaatcaagaatcttgaatatacg
attgataagaaactgggctgtggtggctcaagctctgtttatttggcacgtcgatcggac
tccggagatgagttcgcccttaaggtggtggatctgcaggccgatccacaagtggtgcag
ggatatctaaacgaaaccaaactcctggcaaagctgcaaggaaacgtttgtgttgtggca
ctttacgattatcaacttgtgcgcgaagagtccaagctgtacatggtgatggagaagggc
gactgcgacctaaacaagatccttcagagctacaccaccaaccttcctctctatagcctg
atgaacatcctttaccaaatgctgcaagcggtcaactacatccaccaaaacggtgtcatc
cattcggatctcaagccggcaaatttcctaatggttagcggcagactgaaactgatcgat
tttggcatagccagcaatatctctttggactcgacgagcatcatcaaattctcccaggcg
ggcacctttaactacattagtccggaagcgttaacggacacctctacggggaatagcccg
gtacgcggagccaaccaacccaagatcaagatctcgaccaagtctgacgtgtggtcgctt
ggctgcattctttacctgttgctctaccaaaagacaccgttcggccacatccgaaacatc
tatgccaagatgagtgctatcgccactccggccaccagcatcgagtatcccgccattcct
ccctactatcccatcatgctggttcatatggccaagaactgccttcagctgaatcccaaa
aagcggccgtcgtgcactgaactactgcagtacccattccatatgatcattccgctacag
aacctgcagatacccagcagaaccgccaccagcaattaa

DBGET integrated database retrieval system