KEGG   Drosophila yakuba: Dyak_GE25519Help
Entry
Dyak_GE25519      CDS       T01068                                 

Gene name
dyak_GLEANR_9143
Definition
(RefSeq) GE25519 gene product from transcript GE25519-RC
  KO
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dya  Drosophila yakuba
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dyak_GE25519 (dyak_GLEANR_9143)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dyak_GE25519 (dyak_GLEANR_9143)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 704 aa AA seqDB search
MHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTAAAQPSAALSSSERQQQQQSTG
YQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRFLRPTQAKKAPLPMSESF
LFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHELQRMGVPVVAGIGP
HGPRAPTERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAH
NAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQPQ
STALLEQMLTQVIELHLQCLGQATPASAVPVAPIRFTHIHIGCDEVQRMGECTTCRQRLR
SELFLSHVVSIAHFIRRQWPQLAVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYASDIY
RYIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGGRFSK
GLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQCVFQ
PDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLYEKLAEIGLYLQQTRDQSAW
LSDYNVRHNFSSPLRVRELTGRVPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQHIYP
TIEALQRQLARAEMLLQRRTWPQRPLPLPLKVKEDMGLVTYQQQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcactcaaatctgtggatatttatttggcgccggaaactttccttcctgctcgtcgtg
tctggcctggtgcttctcggcctctggacatgggccatactaatcgatacgacagccgca
gcacagccttccgccgccctctccagttctgagcgccagcagcagcagcagtccacgggc
taccagcaggttcacatcatccaaaagctgatcgagcaggccaaccgggtgctgagagcc
gagcgactcaaggataacgccgtcgagaagtcgccgtcgccagtccagcggctgggaaac
gtgcgattcctgcggcccacgcaagccaagaaggccccgctgcccatgtccgagagtttt
ctgttcgagcaggaacgccttaagattctggagcagcagcagcgccagagaaacgccggc
atggaggaactgaacgccaatgcggaggacgagcgaatgctcagttcggcggagcgacag
actcagtacgagcacgagctccagcggatgggtgtcccggtggtggctggcatcgggccc
catggtccaagagctcccaccgagcgtctggtgcatctggatctgaagggtgctccgccc
aagctcagcttcctcaagcaactgcttcccgtgctgcgggctctgggagccactggtctg
ctcatagagtacgaggacatgtttccctacagcggcgttctccagccgctggcagcgcac
aatgcctacaaggaggacgaactgcgggactttctggagtgcgctgccctccacgggctg
agtgtaatgcccctcgtccaaaccttcgggcacatggaatacgtcctgaaactgtctggc
ttcgagcagctgcgagagctggctgagagtccacagtcgatctgccccagccagccgcag
agcacggcgctactggagcagatgctcacccaagtgattgaactgcacttgcagtgcttg
ggtcaggcgacacccgcctccgcagttcccgtggcacctatccggttcacccacatccac
attggctgtgacgaggtgcagcgcatgggcgagtgcaccacctgccgccagaggctgcgc
agtgagctctttctctcgcacgtggtcagcattgcgcacttcatccgccgccagtggccg
cagcttgcagtggtaatctgggacgaccagttgcgatcgatgtctctcagcgagctgcag
cactcgcaagtgggcagctacgtggagccgatggtgtgggtttatgccagtgacatatac
cggtacatccagccacagctgtgggatacctatgccaaggtctttcccagcgcctggacg
gcgtccgctttcaagggagccttcggcgagagcttgttggtgccgccgctgcagcatcat
cttgagaacaacatccgctggctggcagtgatcgccaaggaaggcggacgcttctcaaaa
ggattgagaggtctggccctgaccggatggcagcggtacgaccacttcgcagtactctgc
gaactcctaccagtgggcattcccagtttgatgacgtcgctgtctaccgtctcaaaggga
tatttcagcaccaatccgcgggacaatgagctcttgcgtgtgctgcagtgcgtcttccag
ccggacagtcggcgatcgggtcgaccgtggctggaactgcatccgaatgcccatcacagc
cagctctttgctgtctgcaactacccgggtcacctggttttcaaatatgccctgcgcctg
tacgaaaagctggcagagatcggtctctatttgcagcagacccgggaccagagcgcctgg
ctttccgactacaatgtgcggcacaacttcagttcgccgctacgggtgcgcgaactgact
ggcagggtgcccatgctcatcgaagagcttcgggccatggcgcgggaggcgcagcagctg
ctgtgggaggtgtacgacgagtacacggtgacggagttcgtggagcagcacatttatccc
accattgaggcactgcagcgccagttggccagggccgaaatgctgctccagcgacgtact
tggccacagagacctctgcctctgccgttgaaagtgaaggaggacatgggactggtgaca
taccagcagcagtaa

DBGET integrated database retrieval system