KEGG   Drosophila yakuba: Dyak_GE25519Help
Entry
Dyak_GE25519      CDS       T01068                                 

Definition
GE25519 gene product from transcript GE25519-RA
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dya  Drosophila yakuba
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dya00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 828 aa AA seqDB search
MPQLLNRLKRRTDDDSSTDFGPSPKRSKDMHLNKDSRSSCSIPRLEDDDTKGSIESGYFP
ELGPKENPYYLQNQLLFNLHVDREKRREINNNFLKILDAVDVKLDEEVYEEVEVTATQEM
ARDAMHSNLWIFIWRRKLSFLLVVSGLVLLGLWTWAILIDTTAAAQPSAALSSSERQQQQ
QSTGYQQVHIIQKLIEQANRVLRAERLKDNAVEKSPSPVQRLGNVRFLRPTQAKKAPLPM
SESFLFEQERLKILEQQQRQRNAGMEELNANAEDERMLSSAERQTQYEHELQRMGVPVVA
GIGPHGPRAPTERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQP
LAAHNAYKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICP
SQPQSTALLEQMLTQVIELHLQCLGQATPASAVPVAPIRFTHIHIGCDEVQRMGECTTCR
QRLRSELFLSHVVSIAHFIRRQWPQLAVVIWDDQLRSMSLSELQHSQVGSYVEPMVWVYA
SDIYRYIQPQLWDTYAKVFPSAWTASAFKGAFGESLLVPPLQHHLENNIRWLAVIAKEGG
RFSKGLRGLALTGWQRYDHFAVLCELLPVGIPSLMTSLSTVSKGYFSTNPRDNELLRVLQ
CVFQPDSRRSGRPWLELHPNAHHSQLFAVCNYPGHLVFKYALRLYEKLAEIGLYLQQTRD
QSAWLSDYNVRHNFSSPLRVRELTGRVPMLIEELRAMAREAQQLLWEVYDEYTVTEFVEQ
HIYPTIEALQRQLARAEMLLQRRTWPQRPLPLPLKVKEDMGLVTYQQQ
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaacttttgaatcgattgaaacgcagaactgatgacgattcatccaccgatttc
ggtccttcgccgaagcgttccaaggacatgcatctgaataaagacagtaggagcagctgc
agcattccgcgtttggaggacgacgataccaagggatctatagaatcagggtactttccg
gaactcggacccaaggaaaatccctactacttacagaaccagctgcttttcaacttgcat
gtcgaccgggaaaagcgcagggaaataaataataatttcttaaaaattttggacgcggtg
gatgtgaagctagatgaggaggtgtatgaggaggtggaggtgacagccacccaggaaatg
gccagggacgccatgcactcaaatctgtggatatttatttggcgccggaaactttccttc
ctgctcgtcgtgtctggcctggtgcttctcggcctctggacatgggccatactaatcgat
acgacagccgcagcacagccttccgccgccctctccagttctgagcgccagcagcagcag
cagtccacgggctaccagcaggttcacatcatccaaaagctgatcgagcaggccaaccgg
gtgctgagagccgagcgactcaaggataacgccgtcgagaagtcgccgtcgccagtccag
cggctgggaaacgtgcgattcctgcggcccacgcaagccaagaaggccccgctgcccatg
tccgagagttttctgttcgagcaggaacgccttaagattctggagcagcagcagcgccag
agaaacgccggcatggaggaactgaacgccaatgcggaggacgagcgaatgctcagttcg
gcggagcgacagactcagtacgagcacgagctccagcggatgggtgtcccggtggtggct
ggcatcgggccccatggtccaagagctcccaccgagcgtctggtgcatctggatctgaag
ggtgctccgcccaagctcagcttcctcaagcaactgcttcccgtgctgcgggctctggga
gccactggtctgctcatagagtacgaggacatgtttccctacagcggcgttctccagccg
ctggcagcgcacaatgcctacaaggaggacgaactgcgggactttctggagtgcgctgcc
ctccacgggctgagtgtaatgcccctcgtccaaaccttcgggcacatggaatacgtcctg
aaactgtctggcttcgagcagctgcgagagctggctgagagtccacagtcgatctgcccc
agccagccgcagagcacggcgctactggagcagatgctcacccaagtgattgaactgcac
ttgcagtgcttgggtcaggcgacacccgcctccgcagttcccgtggcacctatccggttc
acccacatccacattggctgtgacgaggtgcagcgcatgggcgagtgcaccacctgccgc
cagaggctgcgcagtgagctctttctctcgcacgtggtcagcattgcgcacttcatccgc
cgccagtggccgcagcttgcagtggtaatctgggacgaccagttgcgatcgatgtctctc
agcgagctgcagcactcgcaagtgggcagctacgtggagccgatggtgtgggtttatgcc
agtgacatataccggtacatccagccacagctgtgggatacctatgccaaggtctttccc
agcgcctggacggcgtccgctttcaagggagccttcggcgagagcttgttggtgccgccg
ctgcagcatcatcttgagaacaacatccgctggctggcagtgatcgccaaggaaggcgga
cgcttctcaaaaggattgagaggtctggccctgaccggatggcagcggtacgaccacttc
gcagtactctgcgaactcctaccagtgggcattcccagtttgatgacgtcgctgtctacc
gtctcaaagggatatttcagcaccaatccgcgggacaatgagctcttgcgtgtgctgcag
tgcgtcttccagccggacagtcggcgatcgggtcgaccgtggctggaactgcatccgaat
gcccatcacagccagctctttgctgtctgcaactacccgggtcacctggttttcaaatat
gccctgcgcctgtacgaaaagctggcagagatcggtctctatttgcagcagacccgggac
cagagcgcctggctttccgactacaatgtgcggcacaacttcagttcgccgctacgggtg
cgcgaactgactggcagggtgcccatgctcatcgaagagcttcgggccatggcgcgggag
gcgcagcagctgctgtgggaggtgtacgacgagtacacggtgacggagttcgtggagcag
cacatttatcccaccattgaggcactgcagcgccagttggccagggccgaaatgctgctc
cagcgacgtacttggccacagagacctctgcctctgccgttgaaagtgaaggaggacatg
ggactggtgacataccagcagcagtaa

DBGET integrated database retrieval system